Query         017783
Match_columns 366
No_of_seqs    319 out of 1226
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 03:24:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017783.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017783hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03106 WRKY:  WRKY DNA -bindi 100.0   2E-31 4.4E-36  204.2   1.6   60  188-247     1-60  (60)
  2 PF03106 WRKY:  WRKY DNA -bindi 100.0 2.1E-31 4.5E-36  204.1   1.1   59    9-67      1-60  (60)
  3 smart00774 WRKY DNA binding do 100.0 3.8E-30 8.3E-35  196.9   4.1   58  188-245     1-59  (59)
  4 smart00774 WRKY DNA binding do 100.0 5.4E-30 1.2E-34  196.1   4.6   57    9-65      1-59  (59)
  5 PF04500 FLYWCH:  FLYWCH zinc f  88.9    0.13 2.8E-06   37.5   0.1   48  188-245    12-62  (62)
  6 PF04500 FLYWCH:  FLYWCH zinc f  86.2    0.22 4.8E-06   36.2   0.0   48    9-65     12-62  (62)
  7 PF03101 FAR1:  FAR1 DNA-bindin  79.6     2.7 5.8E-05   33.3   3.8   60    8-67      7-89  (91)
  8 PF03101 FAR1:  FAR1 DNA-bindin  73.0     2.2 4.8E-05   33.7   1.7   30  217-247    60-89  (91)
  9 PLN03097 FHY3 Protein FAR-RED   34.4      39 0.00085   38.5   3.7   35   35-69    156-190 (846)
 10 PF03859 CG-1:  CG-1 domain;  I  26.2      24 0.00051   31.2   0.2    8   10-17     52-59  (118)
 11 PLN03097 FHY3 Protein FAR-RED   23.9      62  0.0013   37.0   2.9   36  214-250   156-191 (846)

No 1  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.96  E-value=2e-31  Score=204.21  Aligned_cols=60  Identities=68%  Similarity=1.347  Sum_probs=52.6

Q ss_pred             CCCCchhhhccccccCCCCCCcccccccCCCCCcccchhhccCCCCeEEEEEecccCCCC
Q 017783          188 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDV  247 (366)
Q Consensus       188 ~dDGy~WRKYGQK~ikgn~~pRsYYrCt~~gC~akK~Ver~~~D~~~~~~tY~G~HnH~~  247 (366)
                      ++|||+|||||||.|+|+++||+||||++.+|+|+|+|||+.+|+.+++|||+|+|||+.
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~k   60 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHPK   60 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS--
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCCC
Confidence            589999999999999999999999999999999999999999999999999999999973


No 2  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.96  E-value=2.1e-31  Score=204.13  Aligned_cols=59  Identities=54%  Similarity=0.964  Sum_probs=50.7

Q ss_pred             CCCCCCcccccCCCCCCCCCCCCcccCCCCCCCccceeeeec-CCceEEEEecCCCCCCC
Q 017783            9 ARCEIGTEKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-DGQITEIVYKGSHNHPK   67 (366)
Q Consensus         9 ~~Dgy~WRKYGQK~IkGs~~pRsYYrCt~~~C~akK~Vers~-Dg~i~~i~Y~G~HnH~~   67 (366)
                      +||||+|||||||.|+|+++|||||||++.+|+|+|+|||+. |+.+++|+|+|+|||++
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~k   60 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHPK   60 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS--
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCCC
Confidence            689999999999999999999999999999999999999996 78899999999999985


No 3  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.96  E-value=3.8e-30  Score=196.90  Aligned_cols=58  Identities=64%  Similarity=1.261  Sum_probs=56.6

Q ss_pred             CCCCchhhhccccccCCCCCCcccccccC-CCCCcccchhhccCCCCeEEEEEecccCC
Q 017783          188 LDDGYRWRKYGQKVVKGNPNPRSYYKCTH-PGCPVRKHVERASHDLRAVITTYEGKHNH  245 (366)
Q Consensus       188 ~dDGy~WRKYGQK~ikgn~~pRsYYrCt~-~gC~akK~Ver~~~D~~~~~~tY~G~HnH  245 (366)
                      ++|||+|||||||.|+|+++||+|||||+ ++|+|+|+|||+++|+.+++|||+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            47999999999999999999999999999 99999999999999999999999999998


No 4  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.96  E-value=5.4e-30  Score=196.07  Aligned_cols=57  Identities=49%  Similarity=0.890  Sum_probs=55.0

Q ss_pred             CCCCCCcccccCCCCCCCCCCCCcccCCC-CCCCccceeeeec-CCceEEEEecCCCCC
Q 017783            9 ARCEIGTEKYGQKQVKGSENPRSYYKCTF-PSCPTKKKVERSL-DGQITEIVYKGSHNH   65 (366)
Q Consensus         9 ~~Dgy~WRKYGQK~IkGs~~pRsYYrCt~-~~C~akK~Vers~-Dg~i~~i~Y~G~HnH   65 (366)
                      ++|||+|||||||.|+|+++||+|||||+ ++|+|+|+||++. |+.+++|||+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            58999999999999999999999999999 9999999999996 789999999999998


No 5  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=88.87  E-value=0.13  Score=37.51  Aligned_cols=48  Identities=29%  Similarity=0.712  Sum_probs=24.4

Q ss_pred             CCCCchhhhccccccCCCCCCcccccccCC---CCCcccchhhccCCCCeEEEEEecccCC
Q 017783          188 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHP---GCPVRKHVERASHDLRAVITTYEGKHNH  245 (366)
Q Consensus       188 ~dDGy~WRKYGQK~ikgn~~pRsYYrCt~~---gC~akK~Ver~~~D~~~~~~tY~G~HnH  245 (366)
                      +-|||.-.+....      ....|++|+..   +|+|+-.+.  .++  ..++...++|||
T Consensus        12 ~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~--~~~~~~~~~HnH   62 (62)
T PF04500_consen   12 VYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGD--GRVVRTNGEHNH   62 (62)
T ss_dssp             EETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----T--TEEEE-S---SS
T ss_pred             EECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCC--CEEEECCCccCC
Confidence            3488887765544      45689999873   899988776  222  333455599999


No 6  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=86.25  E-value=0.22  Score=36.23  Aligned_cols=48  Identities=15%  Similarity=0.293  Sum_probs=21.1

Q ss_pred             CCCCCCcccccCCCCCCCCCCCCcccCCCC---CCCccceeeeecCCceEEEEecCCCCC
Q 017783            9 ARCEIGTEKYGQKQVKGSENPRSYYKCTFP---SCPTKKKVERSLDGQITEIVYKGSHNH   65 (366)
Q Consensus         9 ~~Dgy~WRKYGQK~IkGs~~pRsYYrCt~~---~C~akK~Vers~Dg~i~~i~Y~G~HnH   65 (366)
                      .=|||.-++....      ..+.|++|+..   +|+|+=.+.  .++.. .+...++|||
T Consensus        12 ~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~~~-~~~~~~~HnH   62 (62)
T PF04500_consen   12 VYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGDGR-VVRTNGEHNH   62 (62)
T ss_dssp             EETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----TTE-EEE-S---SS
T ss_pred             EECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCCCE-EEECCCccCC
Confidence            3456655554443      55789999864   799965554  22222 3444599999


No 7  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=79.65  E-value=2.7  Score=33.25  Aligned_cols=60  Identities=25%  Similarity=0.423  Sum_probs=40.0

Q ss_pred             cCCCCCCcccccCCCC-CCCCCCCCcccCCC----------------------CCCCccceeeeecCCceEEEEecCCCC
Q 017783            8 KARCEIGTEKYGQKQV-KGSENPRSYYKCTF----------------------PSCPTKKKVERSLDGQITEIVYKGSHN   64 (366)
Q Consensus         8 ~~~Dgy~WRKYGQK~I-kGs~~pRsYYrCt~----------------------~~C~akK~Vers~Dg~i~~i~Y~G~Hn   64 (366)
                      -..-||.+|+-=.+.- ++...-+-+|.|..                      -+|+|+=.|-+..+|....+.+..+||
T Consensus         7 A~~~GF~vr~~~s~~~~~~~~~~~~~~~C~r~G~~~~~~~~~~~~~r~~~s~ktgC~a~i~v~~~~~~~w~v~~~~~~HN   86 (91)
T PF03101_consen    7 ARRHGFSVRKSSSRKSKKNGEIKRVTFVCSRGGKYKSKKKNEEKRRRNRPSKKTGCKARINVKRRKDGKWRVTSFVLEHN   86 (91)
T ss_pred             cCcCCeEEEEeeeEeCCCCceEEEEEEEECCcccccccccccccccccccccccCCCEEEEEEEccCCEEEEEECcCCcC
Confidence            3455666666543332 44445556666652                      369998777777777777778999999


Q ss_pred             CCC
Q 017783           65 HPK   67 (366)
Q Consensus        65 H~~   67 (366)
                      |+-
T Consensus        87 H~L   89 (91)
T PF03101_consen   87 HPL   89 (91)
T ss_pred             CCC
Confidence            975


No 8  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=73.00  E-value=2.2  Score=33.72  Aligned_cols=30  Identities=33%  Similarity=0.575  Sum_probs=25.9

Q ss_pred             CCCCcccchhhccCCCCeEEEEEecccCCCC
Q 017783          217 PGCPVRKHVERASHDLRAVITTYEGKHNHDV  247 (366)
Q Consensus       217 ~gC~akK~Ver~~~D~~~~~~tY~G~HnH~~  247 (366)
                      .+|+|+=.|.+.. +..-+++.+..+|||+.
T Consensus        60 tgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   60 TGCKARINVKRRK-DGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             cCCCEEEEEEEcc-CCEEEEEECcCCcCCCC
Confidence            6999999888765 77788889999999986


No 9  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=34.41  E-value=39  Score=38.47  Aligned_cols=35  Identities=26%  Similarity=0.432  Sum_probs=29.4

Q ss_pred             CCCCCCCccceeeeecCCceEEEEecCCCCCCCCC
Q 017783           35 CTFPSCPTKKKVERSLDGQITEIVYKGSHNHPKPQ   69 (366)
Q Consensus        35 Ct~~~C~akK~Vers~Dg~i~~i~Y~G~HnH~~P~   69 (366)
                      |+--+|+|+=.|-+..+|....+-+..+|||+--.
T Consensus       156 ~tRtGC~A~m~Vk~~~~gkW~V~~fv~eHNH~L~p  190 (846)
T PLN03097        156 CAKTDCKASMHVKRRPDGKWVIHSFVKEHNHELLP  190 (846)
T ss_pred             ccCCCCceEEEEEEcCCCeEEEEEEecCCCCCCCC
Confidence            77789999999988778876667799999998753


No 10 
>PF03859 CG-1:  CG-1 domain;  InterPro: IPR005559  CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=26.21  E-value=24  Score=31.24  Aligned_cols=8  Identities=13%  Similarity=-0.122  Sum_probs=7.0

Q ss_pred             CCCCCccc
Q 017783           10 RCEIGTEK   17 (366)
Q Consensus        10 ~Dgy~WRK   17 (366)
                      -|||+|||
T Consensus        52 kDG~~WrK   59 (118)
T PF03859_consen   52 KDGHNWRK   59 (118)
T ss_pred             cccceeEE
Confidence            49999987


No 11 
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=23.90  E-value=62  Score=36.96  Aligned_cols=36  Identities=33%  Similarity=0.629  Sum_probs=29.6

Q ss_pred             ccCCCCCcccchhhccCCCCeEEEEEecccCCCCCCC
Q 017783          214 CTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAA  250 (366)
Q Consensus       214 Ct~~gC~akK~Ver~~~D~~~~~~tY~G~HnH~~p~~  250 (366)
                      |+-.||+|+=.|.+. .|..-+++.+..+|||+.-..
T Consensus       156 ~tRtGC~A~m~Vk~~-~~gkW~V~~fv~eHNH~L~p~  191 (846)
T PLN03097        156 CAKTDCKASMHVKRR-PDGKWVIHSFVKEHNHELLPA  191 (846)
T ss_pred             ccCCCCceEEEEEEc-CCCeEEEEEEecCCCCCCCCc
Confidence            788899999999874 456778888999999988543


Done!