Query         017807
Match_columns 365
No_of_seqs    204 out of 549
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 03:36:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017807.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017807hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0 3.6E-69 7.9E-74  492.6   0.3  215   67-357     1-215 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.4 0.00036 7.9E-09   54.2   5.7   68  247-341     3-71  (84)
  3 smart00666 PB1 PB1 domain. Pho  97.1  0.0023   5E-08   49.7   7.5   66  247-340     3-69  (81)
  4 cd06398 PB1_Joka2 The PB1 doma  96.9  0.0034 7.3E-08   52.1   6.6   68  247-341     2-72  (91)
  5 cd05992 PB1 The PB1 domain is   96.8  0.0071 1.5E-07   46.7   7.4   66  247-340     2-69  (81)
  6 cd06407 PB1_NLP A PB1 domain i  96.8  0.0049 1.1E-07   50.1   6.7   55  247-328     2-56  (82)
  7 cd06396 PB1_NBR1 The PB1 domai  96.2   0.014   3E-07   48.1   6.2   54  247-328     2-55  (81)
  8 cd06401 PB1_TFG The PB1 domain  96.0   0.036 7.8E-07   45.8   7.6   74  247-345     2-79  (81)
  9 cd06404 PB1_aPKC PB1 domain is  95.0   0.065 1.4E-06   44.5   5.8   56  247-329     2-57  (83)
 10 cd06409 PB1_MUG70 The MUG70 pr  94.9   0.051 1.1E-06   45.1   5.1   51  255-328     7-59  (86)
 11 cd06402 PB1_p62 The PB1 domain  94.9   0.098 2.1E-06   43.5   6.8   59  246-329     1-64  (87)
 12 cd06403 PB1_Par6 The PB1 domai  94.6   0.083 1.8E-06   43.6   5.5   68  248-341     3-71  (80)
 13 cd06397 PB1_UP1 Uncharacterize  92.9    0.34 7.3E-06   40.3   6.2   66  248-341     3-69  (82)
 14 cd06408 PB1_NoxR The PB1 domai  90.5    0.83 1.8E-05   38.1   6.1   65  246-340     3-68  (86)
 15 cd06399 PB1_P40 The PB1 domain  53.1      23  0.0005   30.2   4.2   37  261-325    22-58  (92)
 16 PF10411 DsbC_N:  Disulfide bon  46.9      15 0.00033   27.7   2.0   17  314-330    34-50  (57)
 17 cd06406 PB1_P67 A PB1 domain i  43.6   1E+02  0.0022   25.7   6.4   66  246-340     3-69  (80)
 18 cd06395 PB1_Map2k5 PB1 domain   35.9      65  0.0014   27.3   4.3   49  253-328     9-57  (91)
 19 PF11576 DUF3236:  Protein of u  29.3      20 0.00043   33.1   0.2   16   68-83     94-109 (154)
 20 PF09840 DUF2067:  Uncharacteri  26.8      27 0.00058   32.8   0.6   36  304-343    91-126 (190)
 21 KOG3938 RGS-GAIP interacting p  26.4      96  0.0021   31.6   4.4   74  253-354    62-142 (334)
 22 PF07929 PRiA4_ORF3:  Plasmid p  26.2 1.6E+02  0.0034   26.5   5.4   82  246-327     5-106 (179)
 23 PF09582 AnfO_nitrog:  Iron onl  20.1 1.2E+02  0.0027   28.7   3.7   48  310-360    18-83  (202)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=3.6e-69  Score=492.64  Aligned_cols=215  Identities=63%  Similarity=0.973  Sum_probs=6.0

Q ss_pred             CCccccccccCCCCCCCcccCccccccCCCcCCCCCCCCCCCCCCCCCCCccccccCCCcchhhhccccccccccccccc
Q 017807           67 LNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDGFLEGKYLSSSEL  146 (365)
Q Consensus        67 lnlk~TELRLGLPGs~sper~~~~~~~~~~~~~~~~~fpl~p~~~~~~~~~~~~~sg~KRGFsdai~~~~egK~~~~s~~  146 (365)
                      ||||+|||||||||+++|+...                         ...++...+++||||+++|+......+...   
T Consensus         1 ln~~~TELrLGLPG~~~~~~~~-------------------------~~~~~~~~~~~kR~F~~aid~~~~~~~~~~---   52 (215)
T PF02309_consen    1 LNLKATELRLGLPGSESPDASS-------------------------SSSSKKSSSGNKRGFSEAIDSSSSNSQSSS---   52 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCchhhhhcccCCCCCCCCccc-------------------------ccccccccCcccccchhhhhhccccccccc---
Confidence            7999999999999999987211                         012345578999999999986551111000   


Q ss_pred             cCCCCCCCCCCCCCCccccCCCccccccccccccccccCCCCCCCCccCCCCCCCCCCCCCcccCcccCCCCcccccccc
Q 017807          147 LSPRAAPNLGLKSGSIQENLGPQTAKGKEMANQKAVQERPHVNNETITNHNGSASNSSSAPAAKAQVVGWPPIRSFRKNS  226 (365)
Q Consensus       147 ~~~~~~~~~~l~~g~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~p~~kaqVVGWPPIrS~RKN~  226 (365)
                        ....               . .   ..    .. .+...       ......+.....|++++|+||||||++||+|.
T Consensus        53 --~~~~---------------~-~---~~----~~-~~~~~-------~~~~~~~~~~~~p~~~~~~vgwpp~~s~r~n~   99 (215)
T PF02309_consen   53 --SSSS---------------D-S---SS----SS-SSSST-------SSSSSDSSSSSPPASKAQVVGWPPVRSFRKNS   99 (215)
T ss_dssp             ------------------------------------------------------------------BTTBS----S----
T ss_pred             --cccc---------------c-c---Cc----cc-ccccc-------cccccccccCCCCcccccccCCCccccccccc
Confidence              0000               0 0   00    00 00000       00011112234577889999999999999998


Q ss_pred             cccccCCCccccCCCCCCcceEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhcc
Q 017807          227 LATSSKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKD  306 (365)
Q Consensus       227 la~~sk~~~e~~~~~~~~~~yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~d  306 (365)
                      +..         .+....++||||+|||+||||||||++|+||++|+.+|++||.+|.|++|++++      .++..+.+
T Consensus       100 ~~~---------~~~~~~~~~vKV~mdG~~igRkVDL~~~~sY~~L~~~L~~MF~~~~i~~~~~~~------~~~~~~~~  164 (215)
T PF02309_consen  100 LSE---------KQSSSSRSYVKVNMDGVPIGRKVDLSAYSSYEELSSALEKMFSCFSIEQCGSHG------LNESGLLD  164 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccc---------cccccCCceeEEEecCcccceecCHHHhhCHHHHHHHHHHhcCCCCcccccccc------ccchhhcc
Confidence            762         112234799999999999999999999999999999999999999999998743      45566778


Q ss_pred             ccCCCceEEEEEcCCCCeEEccCcChHHHhhhcceeEEecCccccCcchhh
Q 017807          307 LLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGLAPRA  357 (365)
Q Consensus       307 ll~gseyvLtYEDkEGDwMLVGDVPWemFv~svKRLrImk~Seaiglapr~  357 (365)
                      ++++++|+|||||+||||||||||||+|||.+|||||||+.+|++||+|||
T Consensus       165 ~~~~~~~~l~Y~D~egd~mlvGD~PW~~F~~~vkRl~I~~~~e~~~~~~r~  215 (215)
T PF02309_consen  165 LLNGSEYVLVYEDKEGDWMLVGDVPWEEFVKSVKRLRIMKSSEAKGLAPRA  215 (215)
T ss_dssp             ---------------------------------------------------
T ss_pred             ccCCcceeEEEECCCCCEEEecCCCHHHHHHHhhccEEecHHHhcccCCCC
Confidence            888899999999999999999999999999999999999999999999997


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.41  E-value=0.00036  Score=54.20  Aligned_cols=68  Identities=26%  Similarity=0.444  Sum_probs=55.2

Q ss_pred             eEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWML  326 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwML  326 (365)
                      -|||+..|. +=|.+.+..--+|.+|...+++.|...                          ...+.|.|.|.||||..
T Consensus         3 ~vK~~~~~~-~~~~~~~~~~~s~~~L~~~i~~~~~~~--------------------------~~~~~l~Y~D~dgD~V~   55 (84)
T PF00564_consen    3 RVKVRYGGD-IRRIISLPSDVSFDDLRSKIREKFGLL--------------------------DEDFQLKYKDEDGDLVT   55 (84)
T ss_dssp             EEEEEETTE-EEEEEEECSTSHHHHHHHHHHHHHTTS--------------------------TSSEEEEEEETTSSEEE
T ss_pred             EEEEEECCe-eEEEEEcCCCCCHHHHHHHHHHHhCCC--------------------------CccEEEEeeCCCCCEEE
Confidence            589999997 333588888889999999999999741                          24799999999999998


Q ss_pred             ccC-cChHHHhhhcce
Q 017807          327 VGD-VPWEMFIGTCKR  341 (365)
Q Consensus       327 VGD-VPWemFv~svKR  341 (365)
                      +-+ .=|++.+..+++
T Consensus        56 i~sd~Dl~~a~~~~~~   71 (84)
T PF00564_consen   56 ISSDEDLQEAIEQAKE   71 (84)
T ss_dssp             ESSHHHHHHHHHHHHH
T ss_pred             eCCHHHHHHHHHHHHh
Confidence            875 568888888753


No 3  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.13  E-value=0.0023  Score=49.74  Aligned_cols=66  Identities=26%  Similarity=0.419  Sum_probs=52.5

Q ss_pred             eEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWML  326 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwML  326 (365)
                      =|||.-.|.  -|.+-+..--+|.+|...+.+.|..                          ....+.|.|+|.||||..
T Consensus         3 ~vK~~~~~~--~~~~~~~~~~s~~dL~~~i~~~~~~--------------------------~~~~~~l~Y~Dedgd~v~   54 (81)
T smart00666        3 DVKLRYGGE--TRRLSVPRDISFEDLRSKVAKRFGL--------------------------DNQSFTLKYQDEDGDLVS   54 (81)
T ss_pred             cEEEEECCE--EEEEEECCCCCHHHHHHHHHHHhCC--------------------------CCCCeEEEEECCCCCEEE
Confidence            378887554  6777888889999999999999974                          113689999999999987


Q ss_pred             ccC-cChHHHhhhcc
Q 017807          327 VGD-VPWEMFIGTCK  340 (365)
Q Consensus       327 VGD-VPWemFv~svK  340 (365)
                      +.+ .=|.+.+..++
T Consensus        55 l~sd~Dl~~a~~~~~   69 (81)
T smart00666       55 LTSDEDLEEAIEEYD   69 (81)
T ss_pred             ecCHHHHHHHHHHHH
Confidence            665 57887777766


No 4  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=96.86  E-value=0.0034  Score=52.09  Aligned_cols=68  Identities=24%  Similarity=0.279  Sum_probs=51.4

Q ss_pred             eEEEeecCCcccceecCC---CCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCC
Q 017807          247 FVKVSMDGAPYLRKVDLK---NYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGD  323 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~---~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGD  323 (365)
                      -|||.-+|.-+=-++++.   ..-+|++|...+.+.|..                         ....+|+|.|.|.|||
T Consensus         2 ~vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l-------------------------~~~~~~~l~Y~Dedgd   56 (91)
T cd06398           2 VVKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSL-------------------------SPDADLSLTYTDEDGD   56 (91)
T ss_pred             EEEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCC-------------------------CCCCcEEEEEECCCCC
Confidence            489999998555555554   467999999999999974                         1125899999999999


Q ss_pred             eEEccCcChHHHhhhcce
Q 017807          324 WMLVGDVPWEMFIGTCKR  341 (365)
Q Consensus       324 wMLVGDVPWemFv~svKR  341 (365)
                      |..+-+.  +.|...+.+
T Consensus        57 ~V~l~~D--~DL~~a~~~   72 (91)
T cd06398          57 VVTLVDD--NDLTDAIQY   72 (91)
T ss_pred             EEEEccH--HHHHHHHHH
Confidence            9988765  455554443


No 5  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.77  E-value=0.0071  Score=46.65  Aligned_cols=66  Identities=26%  Similarity=0.410  Sum_probs=52.0

Q ss_pred             eEEEeecCCcccceecCC-CCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeE
Q 017807          247 FVKVSMDGAPYLRKVDLK-NYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWM  325 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~-~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwM  325 (365)
                      -|||+-.|.  -|.+=+. .--+|++|...|.+.|...                          ...+.+.|.|.||||.
T Consensus         2 ~vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~--------------------------~~~~~l~y~D~e~d~v   53 (81)
T cd05992           2 RVKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLD--------------------------AVSFKLKYPDEDGDLV   53 (81)
T ss_pred             cEEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCC--------------------------CCcEEEEeeCCCCCEE
Confidence            378888875  4444445 8889999999999999741                          0368999999999999


Q ss_pred             EccC-cChHHHhhhcc
Q 017807          326 LVGD-VPWEMFIGTCK  340 (365)
Q Consensus       326 LVGD-VPWemFv~svK  340 (365)
                      .+.+ .=|++.++.++
T Consensus        54 ~l~sd~Dl~~a~~~~~   69 (81)
T cd05992          54 TISSDEDLEEAIEEAR   69 (81)
T ss_pred             EeCCHHHHHHHHHHHh
Confidence            8887 67887777766


No 6  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=96.76  E-value=0.0049  Score=50.11  Aligned_cols=55  Identities=27%  Similarity=0.373  Sum_probs=44.0

Q ss_pred             eEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWML  326 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwML  326 (365)
                      -|||...|.  -+.+-|..--+|++|...+.++|..-                         +.+.|.|-|.|.||||.+
T Consensus         2 ~vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~~-------------------------~~~~f~LkY~Ddegd~v~   54 (82)
T cd06407           2 RVKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKLD-------------------------DMSAFDLKYLDDDEEWVL   54 (82)
T ss_pred             EEEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCCC-------------------------CCCeeEEEEECCCCCeEE
Confidence            489999997  45566666669999999999999740                         125799999999999997


Q ss_pred             cc
Q 017807          327 VG  328 (365)
Q Consensus       327 VG  328 (365)
                      +-
T Consensus        55 lt   56 (82)
T cd06407          55 LT   56 (82)
T ss_pred             ee
Confidence            64


No 7  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.23  E-value=0.014  Score=48.07  Aligned_cols=54  Identities=15%  Similarity=0.267  Sum_probs=46.1

Q ss_pred             eEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWML  326 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwML  326 (365)
                      -|||.-.|.-+--+++-+..-+|++|...+.++|..                          +  .+.|.|-|.||||.+
T Consensus         2 ~vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l--------------------------~--~f~lKYlDde~e~v~   53 (81)
T cd06396           2 NLKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGL--------------------------N--DIQIKYVDEENEEVS   53 (81)
T ss_pred             EEEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCC--------------------------C--cceeEEEcCCCCEEE
Confidence            389999999777778777788999999999999974                          1  478999999999988


Q ss_pred             cc
Q 017807          327 VG  328 (365)
Q Consensus       327 VG  328 (365)
                      +-
T Consensus        54 ls   55 (81)
T cd06396          54 VN   55 (81)
T ss_pred             EE
Confidence            74


No 8  
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=96.00  E-value=0.036  Score=45.76  Aligned_cols=74  Identities=20%  Similarity=0.451  Sum_probs=50.4

Q ss_pred             eEEEeecCCcccceecCCCCC-ChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYS-KYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWM  325 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~-sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwM  325 (365)
                      -+|+.-.|.  -|.+=+..-. +|.+|...+.+.|...                       +.....+.+.|.|.|||+.
T Consensus         2 iiK~~~g~D--iR~~~~~~~~~t~~~L~~~v~~~F~~~-----------------------~~~~~~flIKYkD~dGDlV   56 (81)
T cd06401           2 ILKAQLGDD--IRRIPIHNEDITYDELLLMMQRVFRGK-----------------------LGSSDDVLIKYKDEDGDLI   56 (81)
T ss_pred             eEEEEeCCe--EEEEeccCccccHHHHHHHHHHHhccc-----------------------cCCcccEEEEEECCCCCEE
Confidence            367777666  4665444433 9999999999999741                       0112479999999999999


Q ss_pred             EccCc---ChHHHhhhcceeEEe
Q 017807          326 LVGDV---PWEMFIGTCKRLRIM  345 (365)
Q Consensus       326 LVGDV---PWemFv~svKRLrIm  345 (365)
                      -+.+-   -|-.=+...+||+|.
T Consensus        57 TIts~~dL~~A~~~~~~~~l~~~   79 (81)
T cd06401          57 TIFDSSDLSFAIQCSRILKLTLF   79 (81)
T ss_pred             EeccHHHHHHHHhcCcceEEEEe
Confidence            99874   344334444555553


No 9  
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=94.98  E-value=0.065  Score=44.49  Aligned_cols=56  Identities=21%  Similarity=0.350  Sum_probs=44.7

Q ss_pred             eEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEE
Q 017807          247 FVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWML  326 (365)
Q Consensus       247 yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwML  326 (365)
                      -||++-.|.-.--.+|.  .-+|++|.+.+..||..                         ..+..|++.|.|.|||---
T Consensus         2 ~~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~-------------------------~~~q~ft~kw~DEEGDp~t   54 (83)
T cd06404           2 RVKAAYNGDIMITSIDP--SISLEELCNEVRDMCRF-------------------------HNDQPFTLKWIDEEGDPCT   54 (83)
T ss_pred             eEEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCC-------------------------CCCCcEEEEEECCCCCcee
Confidence            37999999855555665  77899999999999974                         1234799999999999877


Q ss_pred             ccC
Q 017807          327 VGD  329 (365)
Q Consensus       327 VGD  329 (365)
                      +..
T Consensus        55 iSS   57 (83)
T cd06404          55 ISS   57 (83)
T ss_pred             ecC
Confidence            654


No 10 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=94.95  E-value=0.051  Score=45.10  Aligned_cols=51  Identities=20%  Similarity=0.331  Sum_probs=37.9

Q ss_pred             CcccceecCC--CCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEEcc
Q 017807          255 APYLRKVDLK--NYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVG  328 (365)
Q Consensus       255 ~pIGRKVDL~--~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwMLVG  328 (365)
                      .|-||.+=++  ...||.+|..++.+-|+.-.                       .....|.|.|.|.||||.+.-
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~-----------------------~~~~~~~L~YlDDEgD~VllT   59 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDD-----------------------FETHLYALSYVDDEGDIVLIT   59 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCcc-----------------------ccCCcccEEEEcCCCCEEEEe
Confidence            4567765544  37899999999999996410                       002469999999999999864


No 11 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=94.94  E-value=0.098  Score=43.51  Aligned_cols=59  Identities=27%  Similarity=0.481  Sum_probs=43.6

Q ss_pred             ceEEEeecC---Cccccee--cCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcC
Q 017807          246 LFVKVSMDG---APYLRKV--DLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDK  320 (365)
Q Consensus       246 ~yVKV~MDG---~pIGRKV--DL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDk  320 (365)
                      +.||.+..|   .+=-|.+  |=....+|++|...+.++|..                         +.+..|+|.|.|.
T Consensus         1 ~~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~-------------------------l~~~~ftlky~De   55 (87)
T cd06402           1 LTVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPS-------------------------LRGKNFQLFWKDE   55 (87)
T ss_pred             CeEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHccc-------------------------cCCCcEEEEEECC
Confidence            367777766   2333444  446667999999999999963                         1235799999999


Q ss_pred             CCCeEEccC
Q 017807          321 DGDWMLVGD  329 (365)
Q Consensus       321 EGDwMLVGD  329 (365)
                      |||..-+..
T Consensus        56 eGDlvtIss   64 (87)
T cd06402          56 EGDLVAFSS   64 (87)
T ss_pred             CCCEEeecC
Confidence            999987765


No 12 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=94.64  E-value=0.083  Score=43.63  Aligned_cols=68  Identities=19%  Similarity=0.332  Sum_probs=49.6

Q ss_pred             EEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEEc
Q 017807          248 VKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLV  327 (365)
Q Consensus       248 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwMLV  327 (365)
                      ||..-|..=-=-.+|.....+|++++.-|++||..                          .+..|+|-|.|.+||.+-+
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l--------------------------~~~~f~i~Y~D~~gDLLPI   56 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHI--------------------------PNVDFLIGYTDPHGDLLPI   56 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCC--------------------------CCCcEEEEEeCCCCCEecc
Confidence            66666666222245555569999999999999974                          1247999999999999977


Q ss_pred             c-CcChHHHhhhcce
Q 017807          328 G-DVPWEMFIGTCKR  341 (365)
Q Consensus       328 G-DVPWemFv~svKR  341 (365)
                      - |+-+..=++++++
T Consensus        57 nNDdNf~kAlssa~p   71 (80)
T cd06403          57 NNDDNFLKALSSANP   71 (80)
T ss_pred             cCcHHHHHHHHcCCC
Confidence            5 4566666677773


No 13 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=92.92  E-value=0.34  Score=40.27  Aligned_cols=66  Identities=23%  Similarity=0.346  Sum_probs=51.1

Q ss_pred             EEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEEc
Q 017807          248 VKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLV  327 (365)
Q Consensus       248 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwMLV  327 (365)
                      -||+-+|.  .|++-...-=+|..|.+.|+.+|....                          -.+.|||.|.|||..-+
T Consensus         3 fKv~~~g~--~RRf~~~~~pt~~~L~~kl~~Lf~lp~--------------------------~~~~vtYiDeD~D~ITl   54 (82)
T cd06397           3 FKSSFLGD--TRRIVFPDIPTWEALASKLENLYNLPE--------------------------IKVGVTYIDNDNDEITL   54 (82)
T ss_pred             EEEEeCCc--eEEEecCCCccHHHHHHHHHHHhCCCh--------------------------hHeEEEEEcCCCCEEEe
Confidence            48888887  899988888999999999999998521                          13789999999998755


Q ss_pred             cC-cChHHHhhhcce
Q 017807          328 GD-VPWEMFIGTCKR  341 (365)
Q Consensus       328 GD-VPWemFv~svKR  341 (365)
                      -| .=.+.|..-..|
T Consensus        55 ssd~eL~d~~~~~~~   69 (82)
T cd06397          55 SSNKELQDFYRLSHR   69 (82)
T ss_pred             cchHHHHHHHHhccc
Confidence            44 556666554444


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=90.53  E-value=0.83  Score=38.09  Aligned_cols=65  Identities=20%  Similarity=0.373  Sum_probs=51.5

Q ss_pred             ceEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeE
Q 017807          246 LFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWM  325 (365)
Q Consensus       246 ~yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwM  325 (365)
                      +-|||+-.|.  .|-|-+..--+|++|...+.++|..                           ...++|-|.|. ||..
T Consensus         3 ikVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~---------------------------~~~~~iKykDE-GD~i   52 (86)
T cd06408           3 IRVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGF---------------------------KRRLKIKMKDD-GDMI   52 (86)
T ss_pred             EEEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCC---------------------------CCceEEEEEcC-CCCc
Confidence            5689999998  6777777778899999999999974                           12689999999 9999


Q ss_pred             EccCc-ChHHHhhhcc
Q 017807          326 LVGDV-PWEMFIGTCK  340 (365)
Q Consensus       326 LVGDV-PWemFv~svK  340 (365)
                      -++|- =.++-+.++|
T Consensus        53 ti~sq~DLd~Ai~~a~   68 (86)
T cd06408          53 TMGDQDDLDMAIDTAR   68 (86)
T ss_pred             cccCHHHHHHHHHHHH
Confidence            88873 4455555555


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=53.15  E-value=23  Score=30.21  Aligned_cols=37  Identities=24%  Similarity=0.423  Sum_probs=30.4

Q ss_pred             ecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeE
Q 017807          261 VDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWM  325 (365)
Q Consensus       261 VDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwM  325 (365)
                      =||+.--.|.+|..-..+-|..+                            +-.|-|.|.|||..
T Consensus        22 e~l~~~P~~kdLl~lmr~~f~~~----------------------------dIaLNYrD~EGDLI   58 (92)
T cd06399          22 EDLSSTPLLKDLLELTRREFQRE----------------------------DIALNYRDAEGDLI   58 (92)
T ss_pred             cccccCccHHHHHHHHHHHhchh----------------------------heeeeeecCCCCEE
Confidence            37888889999999888888641                            45789999999985


No 16 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=46.94  E-value=15  Score=27.70  Aligned_cols=17  Identities=29%  Similarity=0.755  Sum_probs=14.5

Q ss_pred             EEEEEcCCCCeEEccCc
Q 017807          314 VLTYEDKDGDWMLVGDV  330 (365)
Q Consensus       314 vLtYEDkEGDwMLVGDV  330 (365)
                      -+.|.|.||+++++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            47899999999999984


No 17 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=43.56  E-value=1e+02  Score=25.69  Aligned_cols=66  Identities=15%  Similarity=0.218  Sum_probs=49.0

Q ss_pred             ceEEEeecCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCC-Ce
Q 017807          246 LFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDG-DW  324 (365)
Q Consensus       246 ~yVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEG-Dw  324 (365)
                      .-|||+-.+   .=.|-...=-+|.+|...|.+-+..                          ++.+-+|.|.|.+. +.
T Consensus         3 ~vvKV~f~~---tIaIrvp~~~~y~~L~~ki~~kLkl--------------------------~~e~i~LsYkde~s~~~   53 (80)
T cd06406           3 YVVKVHFKY---TVAIQVARGLSYATLLQKISSKLEL--------------------------PAEHITLSYKSEASGED   53 (80)
T ss_pred             eEEEEEEEE---EEEEEcCCCCCHHHHHHHHHHHhCC--------------------------CchhcEEEeccCCCCCc
Confidence            358999997   3345556667899999999888863                          12356799998875 55


Q ss_pred             EEccCcChHHHhhhcc
Q 017807          325 MLVGDVPWEMFIGTCK  340 (365)
Q Consensus       325 MLVGDVPWemFv~svK  340 (365)
                      ..++|-=|+.-.+.||
T Consensus        54 v~l~d~dle~aws~~~   69 (80)
T cd06406          54 VILSDTNMEDVWSQAK   69 (80)
T ss_pred             cCcChHHHHHHHHhhc
Confidence            4559999998888887


No 18 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=35.87  E-value=65  Score=27.34  Aligned_cols=49  Identities=20%  Similarity=0.319  Sum_probs=35.0

Q ss_pred             cCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEcCCCCeEEcc
Q 017807          253 DGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVG  328 (365)
Q Consensus       253 DG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYEDkEGDwMLVG  328 (365)
                      +|..+--.||...+=+|.++..++.+....-|                           --.+-|||.|||+.-|-
T Consensus         9 ~gg~vDw~V~~~~~L~F~DvL~~I~~vlp~aT---------------------------~tAFeYEDE~gDRITVR   57 (91)
T cd06395           9 NGGAVDWTVQSGPQLLFRDVLDVIGQVLPEAT---------------------------TTAFEYEDEDGDRITVR   57 (91)
T ss_pred             CCCcccccccCcccccHHHHHHHHHHhccccc---------------------------ccceeeccccCCeeEec
Confidence            34456667777777889999888887764311                           12366999999998874


No 19 
>PF11576 DUF3236:  Protein of unknown function (DUF3236);  InterPro: IPR012019  This family of proteins with unknown function appears to be restricted to Methanobacteria. ; PDB: 3BRC_B.
Probab=29.29  E-value=20  Score=33.06  Aligned_cols=16  Identities=50%  Similarity=0.729  Sum_probs=9.8

Q ss_pred             CccccccccCCCCCCC
Q 017807           68 NLKATELRLGLPGSQS   83 (365)
Q Consensus        68 nlk~TELRLGLPGs~s   83 (365)
                      ||=-.-=|||.|||.|
T Consensus        94 DlvIARGRLGvPGSGS  109 (154)
T PF11576_consen   94 DLVIARGRLGVPGSGS  109 (154)
T ss_dssp             SEEEEEEE-SSTTS-E
T ss_pred             cEEEEcccccCCCCcc
Confidence            4444455999999986


No 20 
>PF09840 DUF2067:  Uncharacterized protein conserved in archaea (DUF2067);  InterPro: IPR019202  This family of archaeal proteins, have no known function. 
Probab=26.79  E-value=27  Score=32.83  Aligned_cols=36  Identities=25%  Similarity=0.398  Sum_probs=29.5

Q ss_pred             hccccCCCceEEEEEcCCCCeEEccCcChHHHhhhcceeE
Q 017807          304 LKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLR  343 (365)
Q Consensus       304 L~dll~gseyvLtYEDkEGDwMLVGDVPWemFv~svKRLr  343 (365)
                      |.+.|.-.+|..-|.+.    .|..|.||+.+++.++||.
T Consensus        91 L~~~L~~~G~~ae~~~~----~i~T~a~~eev~~l~~~Ls  126 (190)
T PF09840_consen   91 LVDALKLLGYKAEYRED----VIKTDAPLEEVVELAERLS  126 (190)
T ss_pred             HHHHHHhCCCeeEEeCC----eEEecCCHHHHHHHHHHHH
Confidence            45666667888888765    8899999999999999873


No 21 
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=26.40  E-value=96  Score=31.55  Aligned_cols=74  Identities=30%  Similarity=0.503  Sum_probs=51.5

Q ss_pred             cCCcccceecCCCCCChHHHHHHHHHhhccccccccCCCCCcchhhhhhhhhccccCCCceEEEEEc--CCCCeEEccCc
Q 017807          253 DGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYED--KDGDWMLVGDV  330 (365)
Q Consensus       253 DG~pIGRKVDL~~y~sY~eLs~aLe~MF~~f~~gq~g~~g~~g~e~~~e~kL~dll~gseyvLtYED--kEGDwMLVGDV  330 (365)
                      +|.|.||   +..|++-+||++.+..-|.+...           |         .     .-+|.-+  -|=+.||-|-.
T Consensus        62 HGSptg~---Ie~fsnv~ELY~kIAe~F~Is~~-----------d---------I-----lfcTlNshKvDM~~llgGqi  113 (334)
T KOG3938|consen   62 HGSPTGR---IEGFSNVRELYQKIAEAFDISPD-----------D---------I-----LFCTLNSHKVDMKRLLGGQI  113 (334)
T ss_pred             cCCccce---ecccccHHHHHHHHHHHhcCCcc-----------c---------e-----EEEecCCCcccHHHHhcCcc
Confidence            4667777   45789999999999999976210           0         0     0111112  23445788888


Q ss_pred             ChHHHh-----hhcceeEEecCccccCcc
Q 017807          331 PWEMFI-----GTCKRLRIMKSTDAIGLA  354 (365)
Q Consensus       331 PWemFv-----~svKRLrImk~Seaigla  354 (365)
                      -.+.|+     .-.|-++|+|+.|+.||.
T Consensus       114 gleDfiFAHvkGq~kEv~v~KsedalGlT  142 (334)
T KOG3938|consen  114 GLEDFIFAHVKGQAKEVEVVKSEDALGLT  142 (334)
T ss_pred             ChhhhhhhhhcCcceeEEEEecccccceE
Confidence            888775     356789999999999986


No 22 
>PF07929 PRiA4_ORF3:  Plasmid pRiA4b ORF-3-like protein;  InterPro: IPR012912 Members of this family are similar to the protein product of ORF-3 (Q44206 from SWISSPROT) found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumourigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process []. Other proteins found in this family are annotated as being putative TnpR resolvases (Q9LCU7 from SWISSPROT, Q50439 from SWISSPROT), but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor (Q7UEI4 from SWISSPROT) and in fact carries a LexA DNA binding domain (IPR006199 from INTERPRO), but no references were found to expand on this. ; PDB: 2I1S_A.
Probab=26.23  E-value=1.6e+02  Score=26.46  Aligned_cols=82  Identities=30%  Similarity=0.453  Sum_probs=46.4

Q ss_pred             ceEEEeecCC--cccceecCCCCCChHHHHHHHHHhhcc-------ccccc--cCCC---CC---c--chhhhhhhhhcc
Q 017807          246 LFVKVSMDGA--PYLRKVDLKNYSKYQELSSALEKMFSC-------FTIGQ--YGSH---GA---L--GREMLSESKLKD  306 (365)
Q Consensus       246 ~yVKV~MDG~--pIGRKVDL~~y~sY~eLs~aLe~MF~~-------f~~gq--~g~~---g~---~--g~e~~~e~kL~d  306 (365)
                      .-+||..+|.  +|=|.|.+..-.+..+|-.++...|+-       |.++.  .+..   +.   .  ......+.+|.+
T Consensus         5 y~lkV~L~~~~p~iwRri~Vp~~~tl~~Lh~~Iq~afgw~~~HL~~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~   84 (179)
T PF07929_consen    5 YQLKVSLKGSKPPIWRRIEVPADITLADLHEVIQAAFGWDDDHLYEFFIGGERYGIPDEDGMDFSEGDEIKDASEVKLGE   84 (179)
T ss_dssp             EEEEEEETT-SS-EEEEEEEETT-BHHHHHHHHHHHTT----S-EEEEEE-TTTSSESSS---------EEETTT-BHHH
T ss_pred             EEEEEEEcCCCCCeEEEEEECCCCCHHHHHHHHHHHhCcCCCEeEEEEECCCccccccccccccccCCCcceeeeEEhhh
Confidence            4678888874  899999999999999999999998852       22210  1110   00   0  001124566777


Q ss_pred             ccCCCceEEEEE-cCCCCeEEc
Q 017807          307 LLHGSEFVLTYE-DKDGDWMLV  327 (365)
Q Consensus       307 ll~gseyvLtYE-DkEGDwMLV  327 (365)
                      ++....-.++|. |--.+|++.
T Consensus        85 ~~~~~~~~~~Y~YDfGD~W~h~  106 (179)
T PF07929_consen   85 LLLEEGDKFTYVYDFGDDWEHE  106 (179)
T ss_dssp             C-BTTC-EEEEEE-TTTTEEEE
T ss_pred             hccCcCCEEEEEEcCCCCEEEE
Confidence            774444455555 777778764


No 23 
>PF09582 AnfO_nitrog:  Iron only nitrogenase protein AnfO (AnfO_nitrog);  InterPro: IPR014287 Proteins in this entry include Anf1 from Rhodobacter capsulatus (Rhodopseudomonas capsulata) and AnfO from Azotobacter vinelandii. They are found exclusively in species which contain the iron-only nitrogenase, and are encoded immediately downstream of the structural genes for the nitrogenase enzyme in these species. 
Probab=20.08  E-value=1.2e+02  Score=28.65  Aligned_cols=48  Identities=33%  Similarity=0.830  Sum_probs=36.9

Q ss_pred             CCceEEEEEcCCCCeEEccCcChHH------------------HhhhcceeEEecCccccCcchhhHhh
Q 017807          310 GSEFVLTYEDKDGDWMLVGDVPWEM------------------FIGTCKRLRIMKSTDAIGLAPRAVEK  360 (365)
Q Consensus       310 gseyvLtYEDkEGDwMLVGDVPWem------------------Fv~svKRLrImk~Seaiglapr~~ek  360 (365)
                      ..+++.+|+..+|+|-++.+.|..+                  |+..|   ||.-..++.|++--..++
T Consensus        18 e~G~v~vy~~~~g~W~~~~e~~f~~~~~~~l~~iR~~~~~li~~L~dC---kifV~~~v~Gi~y~~Le~   83 (202)
T PF09582_consen   18 EPGFVRVYEKDDGKWKVIREIPFELCDAKGLAEIRQKISELIEFLGDC---KIFVAKSVSGIPYSLLEK   83 (202)
T ss_pred             CCcEEEEEECCCCceEEeEEEEeccCCCCCHHHHHHHHHHHHHHhCCc---EEEEEccccCccHHHHHH
Confidence            4689999999999999999999982                  44445   466667788887665554


Done!