BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017828
         (365 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2P1N|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|F Chain F, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
 pdb|2P1Q|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
          Length = 13

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 10/13 (76%), Positives = 13/13 (100%)

Query: 212 QVVGWPPIRSFRK 224
           QVVGWPP+R++RK
Sbjct: 1   QVVGWPPVRNYRK 13


>pdb|3AWJ|A Chain A, Crystal Structure Of The Huperzia Serrata Polyketide
           Synthase 1 Complexed With Coa-Sh
 pdb|3AWJ|B Chain B, Crystal Structure Of The Huperzia Serrata Polyketide
           Synthase 1 Complexed With Coa-Sh
 pdb|3AWK|A Chain A, Crystal Structure Of The Polyketide Synthase 1 From
           Huperzia Serrata
          Length = 402

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 77  GLPGSQSPERGSELCLLG--PAQLDEKPLFPLHPTSDSHYPSQKNVVSGNKR 126
           GL GS     G+   ++G  P   +EKPLF +H   ++  P     ++G+ R
Sbjct: 221 GLVGSALFGDGAAALIVGSDPVPQEEKPLFEIHWAGEAVLPDSDGAINGHLR 272


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.131    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,785,589
Number of Sequences: 62578
Number of extensions: 361383
Number of successful extensions: 617
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 615
Number of HSP's gapped (non-prelim): 8
length of query: 365
length of database: 14,973,337
effective HSP length: 100
effective length of query: 265
effective length of database: 8,715,537
effective search space: 2309617305
effective search space used: 2309617305
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)