Query 017930
Match_columns 363
No_of_seqs 231 out of 726
Neff 4.1
Searched_HMMs 46136
Date Fri Mar 29 04:40:03 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017930.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017930hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 smart00774 WRKY DNA binding do 100.0 5E-31 1.1E-35 201.6 5.0 59 290-348 1-59 (59)
2 PF03106 WRKY: WRKY DNA -bindi 100.0 4E-31 8.8E-36 202.3 1.7 59 291-350 2-60 (60)
3 PF10533 Plant_zn_clust: Plant 99.4 8.5E-14 1.8E-18 102.3 3.7 46 240-288 1-47 (47)
4 PF03101 FAR1: FAR1 DNA-bindin 89.0 0.33 7.1E-06 38.4 2.5 32 319-351 59-90 (91)
5 PF04500 FLYWCH: FLYWCH zinc f 87.1 0.26 5.6E-06 35.8 0.7 48 291-348 13-62 (62)
6 PF05344 DUF746: Domain of Unk 87.0 0.73 1.6E-05 36.7 3.3 59 32-104 1-61 (65)
7 cd07691 Ig_CD3_gamma_delta Imm 22.7 89 0.0019 25.3 2.8 25 292-317 17-51 (69)
8 PF03859 CG-1: CG-1 domain; I 21.7 33 0.00072 30.3 0.2 8 291-298 52-59 (118)
9 KOG0673 Thymidylate synthase [ 15.5 63 0.0014 32.1 0.6 22 291-312 114-156 (293)
10 PF08257 Sulfakinin: Sulfakini 14.9 63 0.0014 16.8 0.2 7 91-97 3-9 (9)
No 1
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.96 E-value=5e-31 Score=201.63 Aligned_cols=59 Identities=63% Similarity=1.222 Sum_probs=56.8
Q ss_pred CCCcccccccCCcccCCCCCCcccccCCCCCCCccccceeecCCCCCEEEEEeeccCCC
Q 017930 290 PPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNH 348 (363)
Q Consensus 290 ~~Dgy~WRKYGQK~Ikgs~~PR~YYrCs~~~gC~A~K~Vqr~~~Dp~~~~vtY~G~H~h 348 (363)
++|||.|||||||.|+|+++||+||||++.+||+|+|+|||+++|+.+++|||+|+|||
T Consensus 1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h 59 (59)
T smart00774 1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH 59 (59)
T ss_pred CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence 36999999999999999999999999996689999999999999999999999999998
No 2
>PF03106 WRKY: WRKY DNA -binding domain; InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.96 E-value=4e-31 Score=202.33 Aligned_cols=59 Identities=63% Similarity=1.278 Sum_probs=51.9
Q ss_pred CCcccccccCCcccCCCCCCcccccCCCCCCCccccceeecCCCCCEEEEEeeccCCCCC
Q 017930 291 PDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSL 350 (363)
Q Consensus 291 ~Dgy~WRKYGQK~Ikgs~~PR~YYrCs~~~gC~A~K~Vqr~~~Dp~~~~vtY~G~H~h~~ 350 (363)
+|||+|||||||.|+|++|||+||||++ .+|+|+|+|||+.+|+.+++|||+|+|||+.
T Consensus 2 ~Dgy~WRKYGqK~i~g~~~pRsYYrCt~-~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~k 60 (60)
T PF03106_consen 2 DDGYRWRKYGQKNIKGSPYPRSYYRCTH-PGCPAKKQVQRSADDPNIVIVTYEGEHNHPK 60 (60)
T ss_dssp -SSS-EEEEEEEEETTTTCEEEEEEEEC-TTEEEEEEEEEETTCCCEEEEEEES--SS--
T ss_pred CCCCchhhccCcccCCCceeeEeeeccc-cChhheeeEEEecCCCCEEEEEEeeeeCCCC
Confidence 6999999999999999999999999995 6999999999999999999999999999973
No 3
>PF10533 Plant_zn_clust: Plant zinc cluster domain; InterPro: IPR018872 This zinc binding domain is found associated with the WRKY domain IPR003657 from INTERPRO [].
Probab=99.43 E-value=8.5e-14 Score=102.31 Aligned_cols=46 Identities=67% Similarity=1.120 Sum_probs=38.6
Q ss_pred cccCCCCCCCccccccc-CCCCCccccCcccccccceEEEEecccccCCC
Q 017930 240 KRKCSSASDNLASAKSC-GVSSGRCHCTKKRKSRVKRVVRVPAVSLRLSD 288 (363)
Q Consensus 240 k~~c~~~~~~~~~~k~~-~~~~~~~~cskrrk~r~kr~irv~ais~~~~d 288 (363)
|++|++ .++.+++ | .+++|+|||+||||+|+||+||||||+.+++|
T Consensus 1 krkC~~--~~~~~~~-~~~sssgrCHCsKkRK~RvKR~irVPAiS~K~AD 47 (47)
T PF10533_consen 1 KRKCHS--HNDSSGK-CKCSSSGRCHCSKKRKSRVKRTIRVPAISSKIAD 47 (47)
T ss_pred CCcccc--cCcccCc-cccCCCCcccCCCcccccceeeEEeecccccccC
Confidence 578998 4444455 4 47889999999999999999999999999875
No 4
>PF03101 FAR1: FAR1 DNA-binding domain; InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ]. This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=89.01 E-value=0.33 Score=38.43 Aligned_cols=32 Identities=41% Similarity=0.584 Sum_probs=26.7
Q ss_pred CCCCccccceeecCCCCCEEEEEeeccCCCCCC
Q 017930 319 VRGCPARKHVERALDDPSMLVVTYEGEHNHSLS 351 (363)
Q Consensus 319 ~~gC~A~K~Vqr~~~Dp~~~~vtY~G~H~h~~~ 351 (363)
-.||+|+=.|.+.. |....++.+..+|||+..
T Consensus 59 ktgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L~ 90 (91)
T PF03101_consen 59 KTGCKARINVKRRK-DGKWRVTSFVLEHNHPLC 90 (91)
T ss_pred ccCCCEEEEEEEcc-CCEEEEEECcCCcCCCCC
Confidence 35899998888766 777888899999999864
No 5
>PF04500 FLYWCH: FLYWCH zinc finger domain; InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif: F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=87.05 E-value=0.26 Score=35.82 Aligned_cols=48 Identities=31% Similarity=0.615 Sum_probs=23.9
Q ss_pred CCcccccccCCcccCCCCCCcccccCCC--CCCCccccceeecCCCCCEEEEEeeccCCC
Q 017930 291 PDDFSWRKYGQKPIKGSPHPRGYYKCSS--VRGCPARKHVERALDDPSMLVVTYEGEHNH 348 (363)
Q Consensus 291 ~Dgy~WRKYGQK~Ikgs~~PR~YYrCs~--~~gC~A~K~Vqr~~~Dp~~~~vtY~G~H~h 348 (363)
-|||.-+++... ....|++|+. ..+|+|+=.+. .++ ..++ ...++|||
T Consensus 13 ~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~-~~~~-~~~~~HnH 62 (62)
T PF04500_consen 13 YDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGD-GRVV-RTNGEHNH 62 (62)
T ss_dssp ETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----T-TEEE-E-S---SS
T ss_pred ECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCC-CEEE-ECCCccCC
Confidence 488887766554 3458999995 23799988777 333 3433 35599998
No 6
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons.
Probab=86.99 E-value=0.73 Score=36.66 Aligned_cols=59 Identities=34% Similarity=0.354 Sum_probs=40.5
Q ss_pred hHHHHHHHHhccchhhhcccCCCCCCCCCCcccccchhHHHHHHHHhhhhhhhhccCCCCCCc--cccccCCCCC
Q 017930 32 ESVEKLINLLSQQQQVQQNNSHQSSPSSRSSMDLENDCKAVADVAVSKFKRVISLLGRNRIGH--ARFRRAPVAA 104 (363)
Q Consensus 32 eS~e~Li~lLSq~~~~~q~~~~~~~~~~~~~~~~~~d~~~itd~AVsKFKkVISLL~rtRTGH--ARFRR~P~~~ 104 (363)
|.++.||++||++-.-.+- ......| ..++..-|.+|++-+=.|| ++|| +|+|-|=.+.
T Consensus 1 ~~~~~fIrlLs~~~s~~~A-----------a~~lG~~-~~~v~~wv~~fR~wll~LD--PSG~~E~RVRLg~r~a 61 (65)
T PF05344_consen 1 EKARAFIRLLSQQISVAQA-----------ADRLGTD-PGTVRRWVRMFRQWLLQLD--PSGHWEARVRLGVRPA 61 (65)
T ss_pred CcHHHHHHHhcccccHHHH-----------HHHHCcC-HHHHHHHHHHHHHHHHHcC--CCCChHHHhhcCCCCC
Confidence 3578999999987422110 0112223 3455678999999999999 8998 9999876543
No 7
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs). The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains. The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta. The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=22.66 E-value=89 Score=25.27 Aligned_cols=25 Identities=36% Similarity=0.938 Sum_probs=17.8
Q ss_pred CcccccccCCcccCC--------C--CCCcccccCC
Q 017930 292 DDFSWRKYGQKPIKG--------S--PHPRGYYKCS 317 (363)
Q Consensus 292 Dgy~WRKYGQK~Ikg--------s--~~PR~YYrCs 317 (363)
.-+.|-| |-..+.- + .-||+-|+|.
T Consensus 17 tsi~W~k-G~~~~~~~~~tlnLGs~~~DPRG~Y~C~ 51 (69)
T cd07691 17 TNITWKK-GKEILEVSNTLLDLGSRINDPRGTYSCK 51 (69)
T ss_pred CcEEEec-CcccccccccEEeccCcccCCCcceEec
Confidence 4478888 7644433 2 6799999997
No 8
>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=21.72 E-value=33 Score=30.31 Aligned_cols=8 Identities=50% Similarity=1.128 Sum_probs=6.9
Q ss_pred CCcccccc
Q 017930 291 PDDFSWRK 298 (363)
Q Consensus 291 ~Dgy~WRK 298 (363)
.|||.|||
T Consensus 52 kDG~~WrK 59 (118)
T PF03859_consen 52 KDGHNWRK 59 (118)
T ss_pred cccceeEE
Confidence 49999995
No 9
>KOG0673 consensus Thymidylate synthase [Nucleotide transport and metabolism]
Probab=15.52 E-value=63 Score=32.14 Aligned_cols=22 Identities=36% Similarity=0.838 Sum_probs=17.7
Q ss_pred CCcccccccCCc---------------------ccCCCCCCcc
Q 017930 291 PDDFSWRKYGQK---------------------PIKGSPHPRG 312 (363)
Q Consensus 291 ~Dgy~WRKYGQK---------------------~Ikgs~~PR~ 312 (363)
--|++||-+|-| .||++|+-|-
T Consensus 114 vyGfqWrHfgA~Y~~~~~dy~gqgvdQL~~vI~~ik~NP~drR 156 (293)
T KOG0673|consen 114 VYGFQWRHFGARYEDCDSDYTGQGVDQLADVINKIKNNPDDRR 156 (293)
T ss_pred ccceeeeecCccccccccccccccHHHHHHHHHHHhcCCccce
Confidence 378999999977 5788888774
No 10
>PF08257 Sulfakinin: Sulfakinin family; InterPro: IPR013259 The sulfakinin (SK) family of neuropeptides have only been identified in crustaceans and insects. For most species there is the potential for producing two sulfakinin peptides, one has a short sulfakinin sequence. The function of the sulfakinins is difficult to assess. For the Periplaneta americana (American cockroach), various forms of the endogenous sulfakinins have been shown to be active on the hindgut, and also on the heart. In Calliphora vomitoria (Blue blowfly) the peptides act as neurotransmitters or neuromodulators, linking the brain with all thoracic and abdominal ganglia. In adults of Penaeus monodon (Penoeid shrimp) they appear to be restricted to a few neurones in the brain with a neural pathway extending along to the ventral thoracic and abdominal ganglia [].
Probab=14.91 E-value=63 Score=16.81 Aligned_cols=7 Identities=57% Similarity=1.075 Sum_probs=5.3
Q ss_pred CCCcccc
Q 017930 91 RIGHARF 97 (363)
Q Consensus 91 RTGHARF 97 (363)
--||-||
T Consensus 3 dyghmrf 9 (9)
T PF08257_consen 3 DYGHMRF 9 (9)
T ss_pred ccccccC
Confidence 3589887
Done!