Citrus Sinensis ID: 017939

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---

MASSDVASMAVEPSKKPRSRRALKPKNSLANEAVVMAQTPSQSPIPNPPDAGLSKENHESLSQPKKAAAKGKAKQATKKQDTSFDKDLQEMQEMLEKMKLEKEKTEELLKEKDEMLKMKEEELELQGKEQEKLHMELKKLQKMKEFKPNMTLPIVQCLKDKEQDRKKKGCAERKRPSPPYILWCKDQWNEAKKENPEAEFKEITNILGAKWKNVSAEEKKPYEEKYQAEKEAYLQVMAKERRESEAMKLLEEEHKQKTAMELLEQYLQFKQEADKENKKPKKEKDPLKPKHPVTAYFLFSSERRAALLADNKNVLEVAKITGEEWKNMTEEQKRPYEEIAKKNKEKYNEEMEAYKRRMKELLV

cccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc

********************************************************************************************************************************************************PIVQC********************PPYILWCKDQWNE*********FKEITNILGAKWK******************EAYLQV*************LEEEHKQKTAMELLEQYL***********************HPVTAYFLFSSERRAALLADNKNVLEVAKITGEEWKNMTEEQKRPYEEIAKKNKEKYNEEMEAYKRRMKEL*V

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSDVASMAVEPSKKPRSRRALKPKNSLANEAVVMAQTPSQSPIPNPPDAGLSKENHESLSQPKKAAAKGKAKQATKKQDTSFDKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLQKMKEFKPNMTLPIVQCLKDKEQDRKKKGCAERKRPSPPYILWCKDQWNEAKKENPEAEFKEITNILGAKWKNVSAEEKKPYxxxxxxxxxxxxxxxxxxxxxSEAMKLLEEEHKQKTxxxxxxxxxxxxxxxxxxxxxPKKEKDPLKPKHPVTAYFLFSSERRAALLADNKNVLEVAKITGEEWKNMTEEQKRPYxxxxxxxxxxxxxxxxxxxxxMKELLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
High mobility group B protein 6		probable	Q9SUP7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TQ6, chain A
Confidence level:very confident
Coverage over the Query: 169-361
View the alignment between query and template
View the model in PyMOL

Template: 2GZK, chain A
Confidence level:very confident
Coverage over the Query: 138-152,163-242
View the alignment between query and template
View the model in PyMOL

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 108-143
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 65-105
View the alignment between query and template
View the model in PyMOL