Citrus Sinensis ID: 017955

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---

MAESPSQAPTPTTPTASDTDPTQYWCHHCEKRVSIETLANLPDVICHECKNGFVESIPVTLTPPFSPPSLTPDHVDDPSFGSQFLQVLRLIAQAARDEDAPQQLTQDPQYGHDFLRIELDGWENDAREDENDENEENRNVDEEGDENENENEDDEENEGGEDRSDNENEENIENEDEEDLRRRWRDVLPLRIRDFATRSRSGRNRILDWAEILNNSIEFRLEAPESDRYIGNPADYMDAAGYEALLQNLAESDGGRRGAPRAAKSAVLELPTVEILSEQETIVCAICKDTVNVGETATKLPCGHVYHGDCIVPWLDSRNTCPVCRFELPTDDPEYEEERKKRVSAGASVGGASGSAGGNLSLG

cccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHccccEEEccccccccccccccccccccEEECcccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccccccc

**********************QYWCHHCEKRVSIETLANLPDVICHECKNGFVESIP*******************PSFGSQFLQVLRLIAQAA**********QDPQYGHDFLRIELDGWEN**********************************************************RWRDVLPLRIRDFATRSRSGRNRILDWAEILNNSIEFRLEAPESDRYIGNPADYMDAAGYEALLQN****************SAVLELPTVEILSEQETIVCAICKDTVNVGETATKLPCGHVYHGDCIVPWLDSRNTCPVCRFELP**********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAESPSQAPTPTTPTASDTDPTQYWCHHCEKRVSIETLANLPDVICHECKNGFVESIPVTLTPPFSPPSLTPDHVDDPSFGSQFLQVLRLIAQAARDEDAPQQLTQDPQYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGGEDRSDNENEENIENEDEEDLRRRWRDVLPLRIRDFATRSRSGRNRILDWAEILNNSIEFRLEAPESDRYIGNPADYMDAAGYEALLQNLAESDGGRRGAPRAAKSAVLELPTVEILSEQETIVCAICKDTVNVGETATKLPCGHVYHGDCIVPWLDSRNTCPVCRFELPTDDPEYEEERKKRVSAGASVGGASGSAGGNLSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase CIP8	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. Probably forms a minimal ubiquitin ligase complex in cooperation with the E2 enzyme UBC8. Its interaction with COP1 suggests that it may participate in proteasome-mediated degradation of HY5 in vivo.	probable	Q9SPL2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 256-331
View the alignment between query and template
View the model in PyMOL

Template: 3NW0, chain A
Confidence level:confident
Coverage over the Query: 239-334
View the alignment between query and template
View the model in PyMOL

Template: 4AYB, chain P
Confidence level:probable
Coverage over the Query: 25-58
View the alignment between query and template
View the model in PyMOL