Citrus Sinensis ID: 017993


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MVRIISMASSIRPSLSTFRFSSSSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAAKPLRGDVNSTGVASSAGNAAQASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
cEEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccEEEEEEEEEEccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEcHHHHHHHHHHHcccEEEEccccccccccEEEEEEcccccEEEEEEccccccccccEEEEEccHHHHHHHHHHHcccEEEEEEccccccEEEEEEEccccccccEEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHcccEEEccccccccccEEEEEEEcccccEEEEEEccccccccc
ccEEEcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHccccccccEEEEEEEEEccHHHHHHHHHHHHccEEEEEccccccccEEEEEccccccccEEEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHcccEEEEcccccccccEEEEEEEccccEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHHccEEEEEcccccccEEEEEEccccccccEEEEEEEccccEEccccccEEEEEEEcccHHHHHHHHHHccccEEcccccccccccEEEEEEcccccEEEEEccHHHHHHcc
MVRIISMassirpslstfrfssssrfglplssftpsrnlvfsplasavpqsqlfglraakplrgdvnstgvassagnaaqASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMkllrkrdipeekytnaflgygpedsHFVIELTynygvdkydigtgfghfgiavDDVAKTVELIKAkggkvtrepgpvkggntviafiedpdgykfellergptpeplcQVMLRVGDLDRSINFYEQAFGMELlrkrdnpeyKYTIAMMGYGPEDKNVVLELTynygvtdydkgnayaqiAIGTDDVYKTAEAIKLFggkvtrepgplpgintkitacldpdgwktvFVDNVDFLKELE
mvriismassirpslstfrfssssrFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAAKPLRGDVNSTGVASSAGNAAQASTSAAHESALEwvkkdkrrMLHVVyrvgdldrtikFYTECLgmkllrkrdipeEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKakggkvtrepgpvkggntvIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAfgmellrkrDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFggkvtrepgplpGINTKItacldpdgwkTVFVDNVDFLKELE
MVRIISMASSIrpslstfrfssssrfglplssfTPSRNLVFSPLASAVPQSQLFGLRAAKPLRGDVNSTGVassagnaaqastsaahesaLEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
**************************************LVF*************************************************LEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFL****
********SS***************************NLVFSPLASAVPQSQLF************************************LEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDF*****
MVRIISMASSIRPSLSTFRFSSSSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAAKPLRGDVNS*********************ALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
*V*******SI*P*********SSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLR*******DVNS******************HESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRIISMASSIRPSLSTFRFSSSSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAAKPLRGDVNSTGVASSAGNAAQASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
Q8W593350 Probable lactoylglutathio yes no 0.964 0.997 0.831 1e-170
Q948T6291 Lactoylglutathione lyase no no 0.787 0.979 0.727 1e-125
Q39366282 Putative lactoylglutathio N/A no 0.765 0.982 0.726 1e-121
P0AC83135 Lactoylglutathione lyase yes no 0.342 0.918 0.637 6e-42
P0AC81135 Lactoylglutathione lyase N/A no 0.342 0.918 0.637 6e-42
P0AC82135 Lactoylglutathione lyase N/A no 0.342 0.918 0.637 6e-42
P0A1Q2135 Lactoylglutathione lyase yes no 0.342 0.918 0.612 4e-41
P0A1Q3135 Lactoylglutathione lyase N/A no 0.342 0.918 0.612 4e-41
P44638135 Lactoylglutathione lyase yes no 0.364 0.977 0.606 2e-40
Q55595131 Probable lactoylglutathio N/A no 0.339 0.938 0.585 5e-39
>sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplast OS=Arabidopsis thaliana GN=At1g67280 PE=2 SV=1 Back     alignment and function desciption
 Score =  597 bits (1538), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 302/363 (83%), Positives = 317/363 (87%), Gaps = 14/363 (3%)

Query: 1   MVRIISMA-SSIRPSLSTFRFSSSSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAA 59
           MVRII MA SSIRPSL+ F  S S RF + L S   SR L        VPQSQLFGL + 
Sbjct: 1   MVRIIPMAASSIRPSLACF--SDSPRFPISLLSRNLSRTL-------HVPQSQLFGLTSH 51

Query: 60  KPLRGDVNSTGVASSAGNAAQASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYT 119
           K LR  VN  GVA S G AAQA+T    +  L WVK DKRRMLHVVYRVGD+DRTIKFYT
Sbjct: 52  KLLRRSVNCLGVAES-GKAAQATT---QDDLLTWVKNDKRRMLHVVYRVGDMDRTIKFYT 107

Query: 120 ECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDD 179
           ECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIG GFGHFGIAVDD
Sbjct: 108 ECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGAGFGHFGIAVDD 167

Query: 180 VAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVG 239
           VAKTVEL+KAKGGKV+REPGPVKGG TVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVG
Sbjct: 168 VAKTVELVKAKGGKVSREPGPVKGGKTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVG 227

Query: 240 DLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNA 299
           DLDR+I FYE+AFGMELLR RDNPEYKYTIAMMGYGPEDK  VLELTYNYGVT+YDKGNA
Sbjct: 228 DLDRAIKFYEKAFGMELLRTRDNPEYKYTIAMMGYGPEDKFPVLELTYNYGVTEYDKGNA 287

Query: 300 YAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLK 359
           YAQIAIGTDDVYKTAEAIKLFGGK+TREPGPLPGI+TKITACLDPDGWK+VFVDN+DFLK
Sbjct: 288 YAQIAIGTDDVYKTAEAIKLFGGKITREPGPLPGISTKITACLDPDGWKSVFVDNIDFLK 347

Query: 360 ELE 362
           ELE
Sbjct: 348 ELE 350




Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 5
>sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 Back     alignment and function description
>sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 Back     alignment and function description
>sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 Back     alignment and function description
>sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 Back     alignment and function description
>sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
359484559362 PREDICTED: probable lactoylglutathione l 1.0 1.0 0.839 1e-180
225445150355 PREDICTED: probable lactoylglutathione l 0.980 1.0 0.837 1e-178
255546389369 lactoylglutathione lyase, putative [Rici 0.972 0.953 0.820 1e-171
449443163362 PREDICTED: probable lactoylglutathione l 0.997 0.997 0.831 1e-171
297841409353 hypothetical protein ARALYDRAFT_475823 [ 0.972 0.997 0.837 1e-170
224119744355 predicted protein [Populus trichocarpa] 0.969 0.988 0.821 1e-169
15220397350 putative lactoylglutathione lyase, chlor 0.964 0.997 0.831 1e-168
21537360350 glyoxalase I, putative [Arabidopsis thal 0.964 0.997 0.826 1e-167
9828630357 F1N21.10 [Arabidopsis thaliana] 0.964 0.977 0.816 1e-166
356513161362 PREDICTED: probable lactoylglutathione l 0.986 0.986 0.797 1e-164
>gi|359484559|ref|XP_003633121.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like isoform 2 [Vitis vinifera] gi|297738782|emb|CBI28027.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 304/362 (83%), Positives = 330/362 (91%)

Query: 1   MVRIISMASSIRPSLSTFRFSSSSRFGLPLSSFTPSRNLVFSPLASAVPQSQLFGLRAAK 60
           MVRII MA+S RPSLS+F FS+SSR G PLS+F  SR +    + SA+PQSQ+FGL A+K
Sbjct: 1   MVRIIPMATSFRPSLSSFGFSTSSRLGFPLSTFNISRTVTSLHVGSAIPQSQIFGLNASK 60

Query: 61  PLRGDVNSTGVASSAGNAAQASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTE 120
            LRG   +    ++ GN A ASTSAA E+ LEWVKKDKRRMLHVVYRVGDLDRTIKFYTE
Sbjct: 61  LLRGGEGNAMGFNATGNIAHASTSAAQENVLEWVKKDKRRMLHVVYRVGDLDRTIKFYTE 120

Query: 121 CLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDV 180
           CLGMKLLR+RDIPEE+YTNAFLGYGPEDSHFVIELTYNYGVDKYDIG GFGHFGIAV+DV
Sbjct: 121 CLGMKLLRRRDIPEERYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGAGFGHFGIAVEDV 180

Query: 181 AKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGD 240
            KTV+LIKAKGGKVTREPGPVKGG+TVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGD
Sbjct: 181 TKTVDLIKAKGGKVTREPGPVKGGSTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGD 240

Query: 241 LDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAY 300
           LDRSINFYE+AFGMELLRKRDNPEYKYTIAMMGYGPEDKN VLELTYNYGV++YDKGN Y
Sbjct: 241 LDRSINFYEKAFGMELLRKRDNPEYKYTIAMMGYGPEDKNAVLELTYNYGVSEYDKGNGY 300

Query: 301 AQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKE 360
           AQIAIGTDDVYKTAEAIKL GGK+TREPGPLPGINTKITAC+DPDGWK+VFVDN+DFLKE
Sbjct: 301 AQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACVDPDGWKSVFVDNIDFLKE 360

Query: 361 LE 362
           L+
Sbjct: 361 LD 362




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225445150|ref|XP_002284023.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255546389|ref|XP_002514254.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223546710|gb|EEF48208.1| lactoylglutathione lyase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449443163|ref|XP_004139350.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297841409|ref|XP_002888586.1| hypothetical protein ARALYDRAFT_475823 [Arabidopsis lyrata subsp. lyrata] gi|297334427|gb|EFH64845.1| hypothetical protein ARALYDRAFT_475823 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224119744|ref|XP_002331150.1| predicted protein [Populus trichocarpa] gi|222873233|gb|EEF10364.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15220397|ref|NP_176896.1| putative lactoylglutathione lyase, chloroplast [Arabidopsis thaliana] gi|75162595|sp|Q8W593.1|LGUC_ARATH RecName: Full=Probable lactoylglutathione lyase, chloroplast; AltName: Full=Glyoxalase I; Flags: Precursor gi|16930396|gb|AAL31884.1|AF419551_1 At1g67280/F1N21_10 [Arabidopsis thaliana] gi|19310505|gb|AAL84986.1| At1g67280/F1N21_10 [Arabidopsis thaliana] gi|332196500|gb|AEE34621.1| putative lactoylglutathione lyase, chloroplast [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21537360|gb|AAM61701.1| glyoxalase I, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9828630|gb|AAG00253.1|AC002130_18 F1N21.10 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356513161|ref|XP_003525282.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
TAIR|locus:2019574350 AT1G67280 [Arabidopsis thalian 0.859 0.888 0.857 1.5e-145
UNIPROTKB|P0AC81135 gloA "GloA" [Escherichia coli 0.342 0.918 0.637 1.6e-40
DICTYBASE|DDB_G0291265136 gloA "glyoxylase I" [Dictyoste 0.342 0.911 0.604 1.9e-37
UNIPROTKB|Q9KT93138 gloA "Probable lactoylglutathi 0.342 0.898 0.604 4.9e-37
TIGR_CMR|VC_1010138 VC_1010 "lactoylglutathione ly 0.342 0.898 0.604 4.9e-37
TIGR_CMR|SO_2044136 SO_2044 "lactoylglutathione ly 0.342 0.911 0.6 4.9e-37
ZFIN|ZDB-GENE-040912-38298 glod4 "glyoxalase domain conta 0.671 0.815 0.321 1.1e-25
RGD|1307010298 Glod4 "glyoxalase domain conta 0.679 0.825 0.294 1.4e-23
MGI|MGI:1914451298 Glod4 "glyoxalase domain conta 0.679 0.825 0.302 1e-22
UNIPROTKB|F1RHJ9496 GLOD4 "Uncharacterized protein 0.676 0.493 0.306 1.5e-22
TAIR|locus:2019574 AT1G67280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1422 (505.6 bits), Expect = 1.5e-145, P = 1.5e-145
 Identities = 270/315 (85%), Positives = 281/315 (89%)

Query:    48 VPQSQLFGLRAAKPLRGDVNSTGVXXXXXXXXXXXXXXXXXXXLEWVKKDKRRMLHVVYR 107
             VPQSQLFGL + K LR  VN  GV                   L WVK DKRRMLHVVYR
Sbjct:    40 VPQSQLFGLTSHKLLRRSVNCLGVAESGKAAQATTQDDL----LTWVKNDKRRMLHVVYR 95

Query:   108 VGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIG 167
             VGD+DRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIG
Sbjct:    96 VGDMDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIG 155

Query:   168 TGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPT 227
              GFGHFGIAVDDVAKTVEL+KAKGGKV+REPGPVKGG TVIAFIEDPDGYKFELLERGPT
Sbjct:   156 AGFGHFGIAVDDVAKTVELVKAKGGKVSREPGPVKGGKTVIAFIEDPDGYKFELLERGPT 215

Query:   228 PEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTY 287
             PEPLCQVMLRVGDLDR+I FYE+AFGMELLR RDNPEYKYTIAMMGYGPEDK  VLELTY
Sbjct:   216 PEPLCQVMLRVGDLDRAIKFYEKAFGMELLRTRDNPEYKYTIAMMGYGPEDKFPVLELTY 275

Query:   288 NYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGW 347
             NYGVT+YDKGNAYAQIAIGTDDVYKTAEAIKLFGGK+TREPGPLPGI+TKITACLDPDGW
Sbjct:   276 NYGVTEYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKITREPGPLPGISTKITACLDPDGW 335

Query:   348 KTVFVDNVDFLKELE 362
             K+VFVDN+DFLKELE
Sbjct:   336 KSVFVDNIDFLKELE 350




GO:0004462 "lactoylglutathione lyase activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0010319 "stromule" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|P0AC81 gloA "GloA" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291265 gloA "glyoxylase I" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KT93 gloA "Probable lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1010 VC_1010 "lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2044 SO_2044 "lactoylglutathione lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-38 glod4 "glyoxalase domain containing 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1307010 Glod4 "glyoxalase domain containing 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914451 Glod4 "glyoxalase domain containing 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHJ9 GLOD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W593LGUC_ARATH4, ., 4, ., 1, ., 50.83190.96400.9971yesno
Q39366LGUL_BRAOG4, ., 4, ., 1, ., 50.72690.76510.9822N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.4.1LOW CONFIDENCE prediction!
4th Layer4.4.1.50.946
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__953__AT1G67280.1
annotation not avaliable (353 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
scaffold_301249.1
annotation not avaliable (258 aa)
      0.418

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
PLN02300286 PLN02300, PLN02300, lactoylglutathione lyase 0.0
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 4e-88
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 1e-60
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 8e-53
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 1e-50
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 4e-40
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 4e-39
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 5e-31
cd08358127 cd08358, Glo_EDI_BRP_like_21, This conserved domai 3e-28
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 1e-23
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 5e-21
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 4e-20
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 9e-20
cd08358127 cd08358, Glo_EDI_BRP_like_21, This conserved domai 8e-17
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 7e-15
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 3e-14
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 2e-12
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 2e-12
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 9e-12
cd07249128 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) 4e-10
COG3324127 COG3324, COG3324, Predicted enzyme related to lact 5e-10
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 1e-09
cd07245114 cd07245, Glo_EDI_BRP_like_9, This conserved domain 1e-09
cd07247114 cd07247, SgaA_N_like, N-terminal domain of Strepto 4e-09
COG3324127 COG3324, COG3324, Predicted enzyme related to lact 5e-09
pfam13669110 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi 1e-08
cd07242128 cd07242, Glo_EDI_BRP_like_6, This conserved domain 2e-08
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 1e-07
cd08346126 cd08346, PcpA_N_like, N-terminal domain of Sphingo 1e-07
cd08362120 cd08362, BphC5-RrK37_N_like, N-terminal, non-catal 2e-07
cd07262123 cd07262, Glo_EDI_BRP_like_19, This conserved domai 3e-07
cd07247114 cd07247, SgaA_N_like, N-terminal domain of Strepto 1e-06
cd07263120 cd07263, Glo_EDI_BRP_like_16, This conserved domai 1e-06
TIGR02295294 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-di 2e-06
cd08345113 cd08345, Fosfomycin_RP, Fosfomycin resistant prote 3e-06
TIGR03081128 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epim 3e-06
cd08348134 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2 4e-06
cd08352125 cd08352, Glo_EDI_BRP_like_1, This conserved domain 4e-06
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 8e-06
cd08349112 cd08349, BLMA_like, Bleomycin binding protein (BLM 9e-06
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 1e-05
cd07267113 cd07267, THT_Oxygenase_N, N-terminal domain of 2,4 1e-05
cd07244121 cd07244, FosA, FosA, a Fosfomycin resistance prote 2e-05
cd07254120 cd07254, Glo_EDI_BRP_like_20, This conserved domai 2e-05
cd07253125 cd07253, Glo_EDI_BRP_like_2, This conserved domain 2e-05
cd07251120 cd07251, Glo_EDI_BRP_like_10, This conserved domai 2e-05
TIGR01263353 TIGR01263, 4HPPD, 4-hydroxyphenylpyruvate dioxygen 7e-05
cd07262123 cd07262, Glo_EDI_BRP_like_19, This conserved domai 2e-04
cd08354122 cd08354, Glo_EDI_BRP_like_13, This conserved domai 2e-04
cd08342136 cd08342, HPPD_N_like, N-terminal domain of 4-hydro 2e-04
cd07237154 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2 2e-04
cd07266121 cd07266, HPCD_N_class_II, N-terminal domain of 3,4 3e-04
cd08343131 cd08343, ED_TypeI_classII_C, C-terminal domain of 0.001
cd08360134 cd08360, MhqB_like_C, C-terminal domain of Burkhol 0.002
TIGR03211303 TIGR03211, catechol_2_3, catechol 2,3 dioxygenase 0.002
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
 Score =  612 bits (1580), Expect = 0.0
 Identities = 257/286 (89%), Positives = 273/286 (95%)

Query: 77  NAAQASTSAAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEK 136
            +A AST+A  E  LEW KKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEK
Sbjct: 1   ASAAASTAAEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEK 60

Query: 137 YTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTR 196
           YTNAFLGYGPEDS+FV+ELTYNYGVDKYDIGTGFGHFGIAV+DVAKTVEL+KAKGGKVTR
Sbjct: 61  YTNAFLGYGPEDSNFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVELVKAKGGKVTR 120

Query: 197 EPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMEL 256
           EPGPVKGG +VIAF++DPDGYKFEL++RGPTPEPLCQVMLRVGDLDRSI FYE+AFGM+L
Sbjct: 121 EPGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGDLDRSIKFYEKAFGMKL 180

Query: 257 LRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEA 316
           LRKRDNPEYKYTIAMMGYGPEDK  VLELTYNYGVT+Y KGNAYAQIAIGTDDVYKTAEA
Sbjct: 181 LRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDDVYKTAEA 240

Query: 317 IKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE 362
           IKL GGK+TREPGPLPGINTKITACLDPDGWKTVFVDN+DFLKELE
Sbjct: 241 IKLVGGKITREPGPLPGINTKITACLDPDGWKTVFVDNIDFLKELE 286


Length = 286

>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
>gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>gnl|CDD|225861 COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>gnl|CDD|225861 COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|176666 cd07242, Glo_EDI_BRP_like_6, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>gnl|CDD|176710 cd08362, BphC5-RrK37_N_like, N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>gnl|CDD|211353 cd07263, Glo_EDI_BRP_like_16, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|213698 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>gnl|CDD|176693 cd08345, Fosfomycin_RP, Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>gnl|CDD|213772 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epimerase Back     alignment and domain information
>gnl|CDD|176696 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211357 cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176688 cd07267, THT_Oxygenase_N, N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>gnl|CDD|176668 cd07244, FosA, FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>gnl|CDD|176677 cd07254, Glo_EDI_BRP_like_20, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211351 cd07251, Glo_EDI_BRP_like_10, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|233334 TIGR01263, 4HPPD, 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176690 cd08342, HPPD_N_like, N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>gnl|CDD|176661 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>gnl|CDD|211354 cd07266, HPCD_N_class_II, N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>gnl|CDD|211355 cd08343, ED_TypeI_classII_C, C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>gnl|CDD|176708 cd08360, MhqB_like_C, C-terminal domain of Burkholderia sp Back     alignment and domain information
>gnl|CDD|234146 TIGR03211, catechol_2_3, catechol 2,3 dioxygenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
PLN02300286 lactoylglutathione lyase 100.0
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 100.0
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 100.0
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 100.0
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.98
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.89
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.86
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.83
PLN02367233 lactoylglutathione lyase 99.83
PLN02367233 lactoylglutathione lyase 99.83
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 99.81
PRK10291129 glyoxalase I; Provisional 99.81
PRK10291129 glyoxalase I; Provisional 99.81
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.79
PLN03042185 Lactoylglutathione lyase; Provisional 99.78
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.78
PLN03042185 Lactoylglutathione lyase; Provisional 99.77
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.77
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.77
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.76
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.76
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.76
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.76
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.76
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.76
PRK11478129 putative lyase; Provisional 99.75
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.75
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.75
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.75
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.75
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.74
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.73
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.73
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.73
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.72
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.72
PLN02300286 lactoylglutathione lyase 99.72
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.72
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.72
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.72
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.72
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.72
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.71
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.71
KOG0638381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 99.71
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.7
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.7
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.7
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.7
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.7
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.7
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.7
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.69
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.69
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.69
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.69
PRK11478129 putative lyase; Provisional 99.69
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.68
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.68
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.68
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.68
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.68
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.67
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.67
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.67
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.67
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.67
PRK06724128 hypothetical protein; Provisional 99.66
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.66
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.66
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.66
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.65
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.65
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.65
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.64
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.64
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.64
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.64
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.64
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.63
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.63
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.62
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.62
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.62
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.62
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.62
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.61
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.61
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.61
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.61
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.6
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.6
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.6
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.6
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.6
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.6
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.59
PRK06724128 hypothetical protein; Provisional 99.59
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.59
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.59
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.59
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.58
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.58
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.58
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.58
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.58
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.57
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.57
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 99.57
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.57
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.57
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.57
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.57
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.57
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.56
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.56
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.56
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.56
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.55
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.55
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.55
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.54
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.54
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.53
KOG2943 299 consensus Predicted glyoxalase [Carbohydrate trans 99.53
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.53
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.53
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.53
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.52
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.52
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.52
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.51
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.51
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.5
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.5
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.5
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.5
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.5
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.5
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.49
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.49
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.49
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.49
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.49
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.48
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.48
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.47
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.46
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.45
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.45
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.44
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.43
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.42
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.42
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.38
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.35
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.33
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.31
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.15
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.14
COG2514 265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.08
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.06
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.04
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 99.0
COG2764136 PhnB Uncharacterized protein conserved in bacteria 98.98
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 98.95
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 98.92
COG2764136 PhnB Uncharacterized protein conserved in bacteria 98.87
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 98.86
COG3607133 Predicted lactoylglutathione lyase [General functi 98.85
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 98.8
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 98.79
COG3607133 Predicted lactoylglutathione lyase [General functi 98.72
KOG0638 381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 98.6
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 98.55
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 98.53
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 98.41
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 98.36
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 98.22
PRK10148147 hypothetical protein; Provisional 98.19
PRK10148147 hypothetical protein; Provisional 98.05
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 97.95
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 97.82
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 97.7
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 96.37
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 96.24
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 95.7
PF15067236 FAM124: FAM124 family 95.66
PF15067236 FAM124: FAM124 family 94.79
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 92.18
PRK11700187 hypothetical protein; Provisional 86.8
COG4747142 ACT domain-containing protein [General function pr 83.8
cd07268149 Glo_EDI_BRP_like_4 This conserved domain belongs t 83.53
PF06185185 YecM: YecM protein; InterPro: IPR010393 This famil 81.78
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
Probab=100.00  E-value=5.5e-44  Score=329.37  Aligned_cols=278  Identities=91%  Similarity=1.487  Sum_probs=231.5

Q ss_pred             cccccchHhhhcccceeeEEEEEeCCHHHHHHHHHHhcCCEEEEEecCCCCceeEEEEeecCCCceEEEEEeecCCCCCC
Q 017993           85 AAHESALEWVKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKY  164 (362)
Q Consensus        85 ~~~~~~~~~~~~~i~~l~hV~l~v~d~~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~~  164 (362)
                      +.......|..+.|.+|+||.|.|+|++++++||+++|||++..+...+...+...++..++...++.+++....+....
T Consensus         9 ~~~~~~~~~~~~~i~~l~Hv~l~V~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~lel~~~~~~~~~   88 (286)
T PLN02300          9 AEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSNFVVELTYNYGVDKY   88 (286)
T ss_pred             hhhhhhhcCCccccceEEEEEEEeCCHHHHHHHHHHhcCCEEEEeeecCCCcEEEEEEccCCCCCceEEEEeccCCCCcc
Confidence            34456667877889999999999999999999999999999987665555556677787765555667777654433333


Q ss_pred             cCCCCeEEEEEEeCCHHHHHHHHHHcCCeeecCCeeccCCCEEEEEEECCCCCEEEEEecCCCCCCcceeeeeeCChHHH
Q 017993          165 DIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRS  244 (362)
Q Consensus       165 ~~g~~~~hiaf~V~Dld~~~~~l~~~G~~~~~~p~~~~~g~~~~~~~~DPdG~~~el~~~~~~~~~i~~v~l~v~D~~~a  244 (362)
                      ..+.++.|++|.|+|+++++++|+++|+++..+|...+.+..+.+||+||+|+.|||++..+.+.++.|+.|.|+|++++
T Consensus        89 ~~~~g~~hia~~v~dvd~~~~~l~~~G~~i~~~~~~~~~g~~~~~~~~DPdG~~iEl~~~~~~~~~~~~~~l~~~d~~~a  168 (286)
T PLN02300         89 DIGTGFGHFGIAVEDVAKTVELVKAKGGKVTREPGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGDLDRS  168 (286)
T ss_pred             ccCCCccEEEEEeCCHHHHHHHHHHCCCeeecCCcccCCCceEEEEEECCCCCEEEEEeCCCCCCcceeEEEEeCCHHHH
Confidence            45668999999999999999999999999998887777666678899999999999999998999999999999999999


Q ss_pred             HHHHHHhhCCeeeeeecCCCCceEEEEeccCCCCcceEEEEeecCCcccccCCCceeEEEEEeCCHHHHHHHHHHcCCee
Q 017993          245 INFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKV  324 (362)
Q Consensus       245 ~~FY~~~LG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~l~~~~~~~~~~~g~g~~hiaf~v~Did~~~~~l~~~G~~v  324 (362)
                      .+||+++|||++......++.+|...++..++......+++..+.+..++..+++.+|++|.|+|+++++++++++|+++
T Consensus       169 ~~Fy~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lel~~~~~~~~~~~g~~~~~i~~~v~di~~~~~~~~~~G~~v  248 (286)
T PLN02300        169 IKFYEKAFGMKLLRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDDVYKTAEAIKLVGGKI  248 (286)
T ss_pred             HHHHHhccCCEEEeeecccccceEEEEEecCCCCCccEEEEeecCCCCccccCCceeEEEEecCCHHHHHHHHHHcCCeE
Confidence            99999999999976555555567777766533334556777665554445567899999999999999999999999999


Q ss_pred             ecCCcccCCCCceEEEEECCCCCeEEEEcccccccccC
Q 017993          325 TREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE  362 (362)
Q Consensus       325 ~~~p~~~~~~~~~~~~~~DPdG~~iel~~~~~~~~~~~  362 (362)
                      +.+|...|+.+++.++|+||||+.|+|++..+|+||||
T Consensus       249 ~~~p~~~p~~~~~~~~~~DPdG~~i~~~~~~~~~~~~~  286 (286)
T PLN02300        249 TREPGPLPGINTKITACLDPDGWKTVFVDNIDFLKELE  286 (286)
T ss_pred             ecCCccCCCCceEEEEEECCCCCEEEEEccchhhhhcC
Confidence            99998888655588999999999999999999999997



>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>PRK11700 hypothetical protein; Provisional Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 8e-43
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 3e-32
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 9e-30
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 4e-22
3zi1_A330 Crystal Structure Of Human Glyoxalase Domain-contai 6e-24
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 1e-13
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 1e-11
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 3e-13
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 1e-10
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 4e-13
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 7e-11
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 9e-13
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 3e-10
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure

Iteration: 1

Score = 171 bits (432), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 79/124 (63%), Positives = 97/124 (78%) Query: 100 RMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNY 159 R+LH + RVGDL R+I FYT+ LGMKLLR + PE KY+ AF+GYGPE VIELTYN+ Sbjct: 2 RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61 Query: 160 GVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKF 219 GVDKY++GT +GH ++VD+ A+ E I+ GG VTRE GPVKGG TVIAF+EDPDGYK Sbjct: 62 GVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKI 121 Query: 220 ELLE 223 EL+E Sbjct: 122 ELIE 125
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure
>pdb|3ZI1|A Chain A, Crystal Structure Of Human Glyoxalase Domain-containing Protein 4 (glod4) Length = 330 Back     alignment and structure
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 2e-64
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 2e-40
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 3e-64
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 7e-42
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 6e-46
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 2e-33
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 2e-40
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 6e-24
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 2e-38
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 2e-12
3oxh_A 282 RV0577 protein; kinase regulation, antibiotic resi 5e-10
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 2e-37
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 5e-23
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 7e-34
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 1e-19
2p25_A126 Glyoxalase family protein; structural genomics, MC 2e-33
2p25_A126 Glyoxalase family protein; structural genomics, MC 2e-18
3r6a_A144 Uncharacterized protein; PSI biology, structural g 2e-32
3r6a_A144 Uncharacterized protein; PSI biology, structural g 8e-21
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 5e-31
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 4e-20
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 5e-28
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 1e-14
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-26
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 7e-18
1ss4_A153 Glyoxalase family protein; structural genomics, PS 1e-25
1ss4_A153 Glyoxalase family protein; structural genomics, PS 1e-15
3e5d_A127 Putative glyoxalase I; structural genomics, joint 3e-25
3e5d_A127 Putative glyoxalase I; structural genomics, joint 4e-15
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-22
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 9e-16
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 1e-21
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 4e-08
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 5e-21
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 5e-16
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 8e-21
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 1e-17
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 1e-18
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 4e-09
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 1e-18
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 5e-07
3ghj_A141 Putative integron gene cassette protein; integron 5e-18
3ghj_A141 Putative integron gene cassette protein; integron 2e-05
3huh_A152 Virulence protein STM3117; structural genomics, ny 7e-18
3huh_A152 Virulence protein STM3117; structural genomics, ny 3e-09
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 7e-18
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 1e-09
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 3e-17
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 1e-07
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 5e-17
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 1e-07
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-16
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-06
1npb_A141 Fosfomycin-resistance protein; manganese binding, 1e-16
1npb_A141 Fosfomycin-resistance protein; manganese binding, 2e-04
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 6e-16
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 1e-07
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 9e-16
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 6e-07
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 2e-15
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 2e-11
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 2e-15
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 3e-09
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 2e-15
1nki_A135 Probable fosfomycin resistance protein; potassium 3e-15
1nki_A135 Probable fosfomycin resistance protein; potassium 1e-04
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 6e-15
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 5e-08
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 9e-15
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-14
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-10
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-14
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-05
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 3e-14
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 5e-14
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 4e-09
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 1e-13
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 1e-13
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-13
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 3e-13
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 3e-05
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 3e-13
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 2e-05
3eck_A365 Protein (homoprotocatechuate 2,3-dioxygenase); oxi 4e-13
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 4e-13
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 3e-05
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 7e-13
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 1e-12
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 2e-12
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 4e-06
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 2e-11
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 8e-07
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 2e-11
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 2e-08
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 3e-11
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 4e-07
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 3e-11
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 1e-05
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 2e-10
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 2e-06
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 2e-10
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 5e-04
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 8e-10
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 3e-05
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 1e-09
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 8e-04
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 1e-09
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 6e-05
2i7r_A118 Conserved domain protein; structural genomics cons 2e-09
2i7r_A118 Conserved domain protein; structural genomics cons 4e-08
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 2e-09
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 7e-05
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 5e-09
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 2e-05
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 4e-08
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 6e-08
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 3e-07
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 3e-04
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 4e-07
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 3e-06
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 4e-07
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 2e-04
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 1e-06
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 8e-04
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 1e-05
1xy7_A166 Unknown protein; structural genomics, protein stru 2e-05
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 2e-04
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 3e-04
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
 Score =  200 bits (510), Expect = 2e-64
 Identities = 70/143 (48%), Positives = 84/143 (58%), Gaps = 5/143 (3%)

Query: 98  KRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTY 157
            RRMLH + RVGDLDR+IKFYTE LGMK+LRK D+PE+KYT  FLGYGPE S  V+ELTY
Sbjct: 6   SRRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTLVFLGYGPEMSSTVLELTY 65

Query: 158 NYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGY 217
           NYGV  Y     +GH  I V+DV + V  ++     +  E          +AF+ DPDGY
Sbjct: 66  NYGVTSYKHDEAYGHIAIGVEDVKELVADMRKHDVPIDYEDES-----GFMAFVVDPDGY 120

Query: 218 KFELLERGPTPEPLCQVMLRVGD 240
             ELL      E     M   G 
Sbjct: 121 YIELLNEKTMMEKAEADMKEQGT 143


>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Length = 418 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Length = 393 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Length = 381 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Length = 424 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Length = 357 Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Length = 166 Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Length = 244 Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 100.0
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 100.0
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 100.0
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 100.0
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 100.0
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 100.0
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 100.0
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 100.0
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 100.0
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 100.0
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 100.0
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 100.0
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 100.0
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 100.0
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.98
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.96
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.95
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.93
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.92
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.92
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.91
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.85
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.84
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.82
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.81
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.81
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.81
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.81
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.8
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.8
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.8
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.8
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.79
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.78
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.78
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.77
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.77
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.77
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.77
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.77
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.77
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.76
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.76
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.76
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.75
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.75
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.75
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.75
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.75
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.75
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.75
3ghj_A141 Putative integron gene cassette protein; integron 99.75
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.75
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.74
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.74
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.74
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.74
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.73
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.73
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.72
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.72
1nki_A135 Probable fosfomycin resistance protein; potassium 99.72
2i7r_A118 Conserved domain protein; structural genomics cons 99.72
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.72
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.71
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.71
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.71
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.71
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.71
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.71
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.71
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.71
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.71
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.71
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.7
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.7
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.7
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.7
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.7
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.69
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.69
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.69
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.69
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.69
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.69
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.69
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.68
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.68
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.68
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.68
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.68
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.68
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.68
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.68
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 99.67
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.67
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.67
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.67
2i7r_A118 Conserved domain protein; structural genomics cons 99.67
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.67
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.67
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.67
3ghj_A141 Putative integron gene cassette protein; integron 99.67
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.67
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.66
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.66
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.66
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.66
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.66
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.65
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.65
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.64
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.64
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.64
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.64
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.63
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.62
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.62
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.62
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.62
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.62
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.62
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.62
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.62
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.61
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.61
1nki_A135 Probable fosfomycin resistance protein; potassium 99.61
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.61
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.61
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.61
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.6
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.6
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.6
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 99.6
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.6
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.6
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.6
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.59
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.59
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.56
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.55
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.55
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.55
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.54
1xy7_A166 Unknown protein; structural genomics, protein stru 99.48
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.47
1xy7_A166 Unknown protein; structural genomics, protein stru 99.42
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.39
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.38
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.37
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.35
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.34
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.3
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.27
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.25
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.21
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.18
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.12
1tsj_A139 Conserved hypothetical protein; structural genomic 99.1
1tsj_A139 Conserved hypothetical protein; structural genomic 99.09
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 99.06
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.05
3l20_A172 Putative uncharacterized protein; hypothetical pro 99.02
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 98.97
3l20_A172 Putative uncharacterized protein; hypothetical pro 98.93
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 98.7
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 98.54
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 98.32
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 98.02
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 97.41
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 96.91
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 94.98
1k4n_A192 Protein EC4020, protein YECM; structural genomics, 83.73
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.3e-34  Score=269.64  Aligned_cols=246  Identities=33%  Similarity=0.584  Sum_probs=191.6

Q ss_pred             hcccceeeEEEEEeCCHHHHHHHHHHhcCCEEEEEecCC-----------CCceeEEEEeecCCCceEEEEEeecCCCCC
Q 017993           95 KKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIP-----------EEKYTNAFLGYGPEDSHFVIELTYNYGVDK  163 (362)
Q Consensus        95 ~~~i~~l~hV~l~v~d~~~a~~FY~~vLG~~~~~~~~~~-----------~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~  163 (362)
                      .+++++|+||.|.|+|++++++||+++|||++..+...+           .+.+..+++.++.......+++........
T Consensus        22 ~M~~~~i~Hv~l~V~Dle~s~~FY~~vLGl~~~~~~~~~~~~~a~~~g~~~~~~~~~~l~~~~~~~~~~leL~~~~~~~~  101 (330)
T 3zi1_A           22 SMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGD  101 (330)
T ss_dssp             GCSCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEEEEC---------CCCSCEEEEEEESSCTTTCCEEEEEEETTCCC
T ss_pred             ecccceeeEEEEEeCCHHHHHHHHHHhcCCeEEEEeecchhhhhhccCCcCCceEEEEEecCCCCCccEEEEeccCCCCc
Confidence            455789999999999999999999999999998776544           345677888887655566778877555444


Q ss_pred             CcCCCCeEEEEEEeCCHHHHHHHHHHcCCeeecCCeeccCCCEEEEEEECCCCCEEEEEecCC-CCCCcceeeeeeCChH
Q 017993          164 YDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGP-TPEPLCQVMLRVGDLD  242 (362)
Q Consensus       164 ~~~g~~~~hiaf~V~Dld~~~~~l~~~G~~~~~~p~~~~~g~~~~~~~~DPdG~~~el~~~~~-~~~~i~~v~l~v~D~~  242 (362)
                      +..++++.|++|.|+|+   .++++++|+++...+    .   ..+||+||||+.|||++... .+.++.|+.|.|.|++
T Consensus       102 ~~~~~g~~hiaf~V~d~---~~~l~~~G~~~~~~~----~---~~~~~~DPdG~~iel~~~~~~~~~~i~hv~L~v~Dl~  171 (330)
T 3zi1_A          102 YKLGNDFMGITLASSQA---VSNARKLEWPLTEVA----E---GVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQ  171 (330)
T ss_dssp             CCBCSSEEEEEEECHHH---HHHHHHHTCCCEEEE----T---TEEEEECTTSCEEEEESSCCTTSCSEEEEEEEESCHH
T ss_pred             cccCCCeeEEEEECchH---HHHHHHcCCceeccC----C---ceEEEECCCCCEEEEEecCCCCCCceeEEEEECCCHH
Confidence            55677999999999987   677889999987443    2   26889999999999998863 5678999999999999


Q ss_pred             HHHHHHHHhhCCeeeeeecCCCCceEEEEeccCCCCcceEEEEeecCCcccccCCCceeEEEEEeC--CHHHHHHHHHHc
Q 017993          243 RSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTD--DVYKTAEAIKLF  320 (362)
Q Consensus       243 ~a~~FY~~~LG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~l~~~~~~~~~~~g~g~~hiaf~v~--Did~~~~~l~~~  320 (362)
                      ++.+||+++|||++.......+  +  .++..++.  ...+++....+  ....+.+..|++|.|+  |+++++++|+++
T Consensus       172 ~a~~FY~~vLG~~~~~~~~~~~--~--~~l~~g~~--~~~l~l~~~~~--~~~~~~~~~hiaf~v~~~dld~~~~rl~~~  243 (330)
T 3zi1_A          172 KSLNYWCNLLGMKIYENDEEKQ--R--ALLGYADN--QCKLELQGVKG--GVDHAAAFGRIAFSCPQKELPDLEDLMKRE  243 (330)
T ss_dssp             HHHHHHHHTTCCEEEEEETTTT--E--EEEESSTT--SCEEEEEECSS--CCCCBTTCCEEEEEECGGGHHHHHHHHHHT
T ss_pred             HHHHHHHHhcCCEEEeeccCCc--E--EEEEeCCc--eEEEEECCCCC--CCCCCCCCceEEEEEEcccHHHHHHHHHHc
Confidence            9999999999999987654332  2  33444332  45666655432  2234567889999995  799999999999


Q ss_pred             CCeeecCCccc--CC-CCceEEEEECCCCCeEEEEcccccc
Q 017993          321 GGKVTREPGPL--PG-INTKITACLDPDGWKTVFVDNVDFL  358 (362)
Q Consensus       321 G~~v~~~p~~~--~~-~~~~~~~~~DPdG~~iel~~~~~~~  358 (362)
                      |+++..+|...  ++ ...+++||+|||||.|||++..++.
T Consensus       244 G~~i~~~~~~~~~pg~~g~~~~~f~DPdG~~iEl~~~~~~~  284 (330)
T 3zi1_A          244 NQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFR  284 (330)
T ss_dssp             TCEEEEEEEEECCTTSCCEEEEEEECTTCCEEEEEEHHHHH
T ss_pred             CCcEecCceecccCCCCceEEEEEECCCCCEEEEEEecccc
Confidence            99988776543  22 1248999999999999999987654



>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 1e-29
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 3e-20
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 1e-26
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 3e-16
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 3e-24
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 8e-14
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 2e-18
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 2e-14
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 7e-18
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 7e-08
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 1e-17
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 2e-08
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 1e-17
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 8e-08
d1sqia1149 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge 1e-16
d1sqia1149 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge 2e-06
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 5e-16
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 6e-06
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 7e-16
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 3e-07
d1ss4a_149 d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu 1e-15
d1ss4a_149 d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu 1e-07
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 2e-15
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 5e-09
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 3e-15
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 2e-07
d1mpya1145 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap 2e-14
d1mpya1145 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap 1e-07
d1f1ua1146 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge 4e-14
d1f1ua1146 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge 8e-06
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 1e-13
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 2e-06
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 6e-12
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 5e-05
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 3e-11
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 0.002
d1lgta1131 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena 5e-11
d1lgta1131 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena 1e-04
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 6e-11
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 3e-05
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 8e-11
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 2e-04
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 2e-10
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 1e-04
d1cjxa2203 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy 4e-10
d1cjxa2203 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy 3e-04
d1klla_128 d.32.1.2 (A:) Mitomycin resistance protein D, MRD 6e-10
d1klla_128 d.32.1.2 (A:) Mitomycin resistance protein D, MRD 0.001
d1kw3b1132 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena 2e-09
d2i7ra1115 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str 5e-09
d2i7ra1115 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str 2e-04
d1kw3b2156 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge 6e-09
d1sp8a2224 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy 1e-08
d1sp8a2224 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy 2e-05
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 2e-08
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 1e-05
d1ecsa_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {K 2e-07
d1cjxa1150 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge 4e-07
d1xy7a_135 d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal 5e-06
d1xy7a_135 d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal 2e-04
d1jifa_122 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 8e-06
d1jifa_122 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 2e-04
d1sqia2210 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy 1e-05
d1sqia2210 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy 1e-04
d1sqda2230 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy 3e-05
d1t47a2199 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy 3e-05
d1t47a2199 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy 6e-04
d1u6la_137 d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudom 4e-04
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Escherichia coli [TaxId: 562]
 Score =  108 bits (270), Expect = 1e-29
 Identities = 80/132 (60%), Positives = 98/132 (74%)

Query: 100 RMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNY 159
           R+LH + RVGDL R+I FYT+ LGMKLLR  + PE KY+ AF+GYGPE    VIELTYN+
Sbjct: 2   RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61

Query: 160 GVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKF 219
           GVDKY++GT +GH  ++VD+ A+  E I+  GG VTRE GPVKGG TVIAF+EDPDGYK 
Sbjct: 62  GVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKI 121

Query: 220 ELLERGPTPEPL 231
           EL+E       L
Sbjct: 122 ELIEEKDAGRGL 133


>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.83
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.82
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.81
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.8
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.79
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.79
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.78
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.78
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.77
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.76
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.76
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.75
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.74
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.74
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.73
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.72
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.72
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.72
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.71
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.71
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.71
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.71
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.7
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.7
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.7
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.7
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.7
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.69
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.69
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.67
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.67
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.66
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.66
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.64
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.64
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.64
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.64
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.63
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.63
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.62
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.62
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.62
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.61
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.61
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.6
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.6
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.59
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.58
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.57
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.56
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.56
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.53
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.49
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.49
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.47
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.44
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.39
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.38
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.38
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.35
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.35
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.28
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.25
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.18
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.16
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.1
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.1
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.06
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 98.99
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 98.97
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 98.89
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 98.87
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 98.87
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 98.7
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 98.69
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 98.65
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 98.15
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 97.97
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 97.16
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 95.61
d1k4na_190 Hypothetical protein YecM (EC4020) {Escherichia co 83.12
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: BC1024-like
domain: Hypothetical protein BC1024
species: Bacillus cereus [TaxId: 1396]
Probab=99.83  E-value=3.4e-20  Score=154.62  Aligned_cols=123  Identities=20%  Similarity=0.221  Sum_probs=89.7

Q ss_pred             hcccceeeEEEEEeCCHHHHHHHHHHhcCCEEEEEecCCCCceeEEEEeecCCCceEEEEEeecCCCCCCcCCCCeEEEE
Q 017993           95 KKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFG  174 (362)
Q Consensus        95 ~~~i~~l~hV~l~v~d~~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~~~~g~~~~hia  174 (362)
                      ++.|++|+||+|.|+|++++++||+++|||++..+.+    .. ..+...++......+......+...... .+++|+|
T Consensus         7 ~~~I~Gl~HV~L~V~Dle~s~~FY~~vLG~~~~~~~~----~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~l~HiA   80 (170)
T d1zswa2           7 KHQIQGMGSVELTVRRLDKMASTLTEIFGYTEVSRND----QE-AIFQSIKGEAFGEIVVKYLDGPTEKPGR-GSIHHLA   80 (170)
T ss_dssp             GGSCCEEEEEEEEESCHHHHHHHHHHTTCCEEEEECS----SE-EEEESSTTCSTTCEEEEECCSSBCBCCB-TCEEEEE
T ss_pred             hHHhCCeeeEEEEeCCHHHHHHHHHHHhCCEEEeecC----ce-EEEEeccCccceEEEeccccccccccCc-cccceEE
Confidence            7789999999999999999999999999999988754    22 2333333322222222222222222222 3799999


Q ss_pred             EEeCC---HHHHHHHHHHcCCeeecCCeeccCCCEEEEEEECCCCCEEEEEecCC
Q 017993          175 IAVDD---VAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGP  226 (362)
Q Consensus       175 f~V~D---ld~~~~~l~~~G~~~~~~p~~~~~g~~~~~~~~DPdG~~~el~~~~~  226 (362)
                      |.|+|   ++++.++|+++|+++.+ +  ...+.++++||+|||||+|||+++.|
T Consensus        81 f~V~~~~~l~~~~~~l~~~G~~~~~-~--~~~~~~~s~Yf~DPdG~~iEl~t~~p  132 (170)
T d1zswa2          81 IRVKNDAELAYWEEQVKQRGFHSSG-I--IDRFYFKSLYFRESNGILFEIATDGP  132 (170)
T ss_dssp             EEESSHHHHHHHHHHHHHTTCCCCC-C--EECSSEEEEEEECTTCCEEEEEEEEE
T ss_pred             EEeCChHHHHHHHHHHHhcCCCccc-c--ccCCCEEEEEEECCCCcEEEEEECCC
Confidence            99986   88999999999999753 2  33456889999999999999998754



>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure