BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018034
         (362 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|A5VLL4|RPOB_LACRD DNA-directed RNA polymerase subunit beta OS=Lactobacillus reuteri
            (strain DSM 20016) GN=rpoB PE=3 SV=1
          Length = 1202

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 298  YGCDYDMKGHLTYGKIGEWRFDKRSYDSVPPPRNLPLPPPGVPESVVTLVK 348
            YG  Y ++  LTY K  +     R+YD++   +  P+P PGVPES   LVK
Sbjct: 1084 YGAAYTLQEILTY-KSDDTVGRVRTYDAIINGQ--PIPKPGVPESFRVLVK 1131


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.320    0.138    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 147,596,397
Number of Sequences: 539616
Number of extensions: 6566195
Number of successful extensions: 15774
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 15774
Number of HSP's gapped (non-prelim): 4
length of query: 362
length of database: 191,569,459
effective HSP length: 119
effective length of query: 243
effective length of database: 127,355,155
effective search space: 30947302665
effective search space used: 30947302665
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)