Citrus Sinensis ID: 018104

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MKRVYLLAAFLLALVLGIVEGFDFHEKELESEEGLWDLYERWRSHHTVSRSLDEKHKRFNVFKQNVMHVHQTNKMDKPYKLKLNKFADMTNHEFASTYAGSKIKHHRMFQGTRGNGTFMYGKVTSIPPSVDWRKKGSVTAVKDQGQCGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL
cHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEECccEEEcccccHHHHHHHHHcccEEEEECcccccccccccccccccccccccEEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccccccccccccccccccccccccc
*KRVYLLAAFLLALVLGIVEGFDFHEKELESEEGLWDLYERWRSHHTVSRSLDEKHKRFNVFKQNVMHVHQTNKMDKPYKLKLNKFADMTNHEFASTYAGS***************TFMYGKVTSIPPSVDWRKKGSVTAVKDQGQCGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI******************
xxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRVYLLAAFLLALVLGIVEGFDFHEKELESEEGLWDLYERWRSHHTVSRSLDEKHKRFNVFKQNVMHVHQTNKMDKPYKLKLNKFADMTNHEFASTYAGSKIKHHRMFQGTRGNGTFMYGKVTSIPPSVDWRKKGSVTAVKDQGQCGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
KDEL-tailed cysteine endopeptidase CEP1 Involved in the final stage of developmental programmed cell death and in intercalation of new cells. Cleaves extensins, thus probably supporing the final cell collapse.confidentQ9FGR9
Vignain Involved in programmed cell death.probableO65039
Vignain Thought to be involved in the hydrolysis of stored seed proteins.probableP25803

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.22.-Cysteine endopeptidases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S4V, chain A
Confidence level:very confident
Coverage over the Query: 125-348
View the alignment between query and template
View the model in PyMOL
Template: 1PCI, chain A
Confidence level:very confident
Coverage over the Query: 29-343
View the alignment between query and template
View the model in PyMOL