BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018182
         (359 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From
           Pisum Sativum (Psamadh2)
 pdb|3IWJ|B Chain B, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From
           Pisum Sativum (Psamadh2)
          Length = 503

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 15/73 (20%)

Query: 84  MIKAFAAGVILATGFVHILPDAFDNLTSPCLVENPWGDFPFSGFVAMMSAIGTLMIDTFA 143
           + KAF AG++              N + PC  + PWG    SGF      +G   +D + 
Sbjct: 436 VTKAFKAGIVWV------------NCSQPCFTQAPWGGVKRSGF---GRELGEWGLDNYL 480

Query: 144 TGYYKRQHFNCKP 156
           +     Q+ + +P
Sbjct: 481 SVKQVTQYISEEP 493


>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Spinach In Complex With Nad
 pdb|4A0M|B Chain B, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Spinach In Complex With Nad
 pdb|4A0M|C Chain C, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Spinach In Complex With Nad
 pdb|4A0M|D Chain D, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Spinach In Complex With Nad
          Length = 496

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 10/51 (19%)

Query: 108 NLTSPCLVENPWGDFPFSGFVAMMSAIG----------TLMIDTFATGYYK 148
           N + PC V+ PWG    SGF   +   G          T  I     G+YK
Sbjct: 445 NCSQPCFVQAPWGGIKRSGFGRELGEWGIQNYLNIKQVTQDISDEPWGWYK 495


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.396 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,336,750
Number of Sequences: 62578
Number of extensions: 291277
Number of successful extensions: 537
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 536
Number of HSP's gapped (non-prelim): 2
length of query: 359
length of database: 14,973,337
effective HSP length: 100
effective length of query: 259
effective length of database: 8,715,537
effective search space: 2257324083
effective search space used: 2257324083
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)