Citrus Sinensis ID: 018192


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MNSPSTQYVTPRRLGIYEPIHQMSTWVENFKSNGNPNTSAPIIVEVDTRLDNQSEDTSHGSQGPFCKYEQEASKPFDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLVQLEQELDRARQQGLYVGSGVEGVHMGFSGTVNSAFEMEYGHWLEEQSRQICELRNALQAHIGDVELRILVDAGMSHYFELFRMKTTAAKADVFYVMSGMWKTPAERFFFWIGGFRPSELLKVLVPQLEPLTEQQLIDVCNLRQSCQQAEDALSQGMDKLQQTLAETVAAGQLAEVGYNPRTGTAMDKLEALVSFVSQADHLRQETLQQMSRILTTRQAARGLLALGEYFLRLRALSSLWANRPREPT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*********TPRRLGIYEPIHQMSTWVEN*************************************************************************QLETSRLKLVQLEQELDRARQQGLYVGSGVEGVHMGFSGTVNSAFEMEYGHWLEEQSRQICELRNALQAHIGDVELRILVDAGMSHYFELFRMKTTAAKADVFYVMSGMWKTPAERFFFWIGGFRPSELLKVLVPQLEPLTEQQLIDVCNLRQSC*************LQQTLAETVAAGQLAEVGYNPRTGTAMDKLEALVSFVSQADHLRQETLQQMSRILTTRQAARGLLALGEYFLRLRALSSLWANR*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSPSTQYVTPRRLGIYEPIHQMSTWVENFKSNGNPNTSAPIIVEVDTRLDNQSEDTSHGSQGPFCKYEQEASKPFDKIQRRLAQNREAARKSRLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLYVGSGVEGVHMGFSGTVNSAFEMEYGHWLEEQSRQICELRNALQAHIGDVELRILVDAGMSHYFELFRMKTTAAKADVFYVMSGMWKTPAERFFFWIGGFRPSELLKVLVPQLEPLTEQQLIDVCNLRQSCQQAEDALSQGMDKLQQTLAETVAAGQLAEVGYNPRTGTAMDKLEALVSFVSQADHLRQETLQQMSRILTTRQAARGLLALGEYFLRLRALSSLWANRPREPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor TGA1 Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.confidentQ39237
Transcription factor TGA4 Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.probableQ39162
TGACG-sequence-specific DNA-binding protein TGA-1A Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.probableP14232

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DH3, chain A
Confidence level:confident
Coverage over the Query: 78-124
View the alignment between query and template
View the model in PyMOL
Template: 3ITF, chain A
Confidence level:probable
Coverage over the Query: 241-348
View the alignment between query and template
View the model in PyMOL