Citrus Sinensis ID: 018203

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
ccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEcccccccHHHHHHHHHHHHHcccccccccEEEEEEEccccccccccccHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEcccccEEccEEEEEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccc
ccHHHccEEEEEcccccccccEEccHHHcccEHHHHHHHHHHHHHHHHHHcHHHccccEEEEEEccHHHHHHHHHHHHcHHHHHccccEEEEEEEEEccccccccccccccEHHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHcccccccccccccccccHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccEcHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHccHHHcccccEccccEEEEcccEEEEEEEEcccEEEEEEccccccHHHHcHHHHHHHHHHHHHcccccccccccccc
mswnkasnllfvespagvgwsysnttsdyncgdastaRDMHVFMMNWYekfpefksrelfltgesyaghyipQLADVLLdhnahskgfkfnikgvaignpllrldqdvpaIYEFFWshgmisdeigltimsdcdfddyvsgtshnmTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHAnrtnlpygwsmcsgvlnysdtdsniniLPVLKRIIQngipvwvfsgdqdsvvpllgsRTLIRELARDLNfevtvpygawfhkqqvggwgteygNLLTFVTVRGaahmvpyaqpsralhlfssfvhgrrlpnntrpaiqd
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSfvhgrrlpnntrpaiqd
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
*******NLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVE**********KMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV*************SVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRR***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
Q9FH05473 Serine carboxypeptidase-l yes no 1.0 0.758 0.766 1e-171
Q9MAR8479 Serine carboxypeptidase-l no no 0.997 0.747 0.721 1e-161
Q9FH06469 Serine carboxypeptidase-l no no 1.0 0.765 0.696 1e-155
Q84W27442 Serine carboxypeptidase-l no no 0.888 0.721 0.669 1e-139
Q8VY01465 Serine carboxypeptidase-l no no 0.969 0.748 0.450 2e-89
Q93Y09461 Serine carboxypeptidase-l no no 0.952 0.741 0.450 1e-86
P52711516 Serine carboxypeptidase I N/A no 0.927 0.645 0.425 1e-70
Q8L9Y0473 Serine carboxypeptidase-l no no 0.944 0.716 0.4 1e-69
Q9ZQQ0452 Serine carboxypeptidase-l no no 0.930 0.738 0.404 2e-69
Q0WRX3502 Serine carboxypeptidase-l no no 0.927 0.663 0.397 3e-69
>sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 Back     alignment and function desciption
 Score =  600 bits (1548), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 275/359 (76%), Positives = 312/359 (86%)

Query: 1   MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELF 60
           MSWNKAS+LLFVESPAGVGWSYSN +SDYN GD STA DM VF++ W+EKFP+ KSR+LF
Sbjct: 115 MSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKSTANDMLVFLLRWFEKFPKLKSRDLF 174

Query: 61  LTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGM 120
           LTGESYAGHYIPQLAD +L +N+HS GFKFNIKGVAIGNPLL+LD+D PA YEFFWSHGM
Sbjct: 175 LTGESYAGHYIPQLADAILSYNSHSSGFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGM 234

Query: 121 ISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV 180
           ISDE+ LTI S CDFDDY   + HN++ +C EAI+E   I+ +Y+NNYDV+LDVCYP+IV
Sbjct: 235 ISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIV 294

Query: 181 EQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD 240
           +QELRL+KMATKMS+GVDVCMT ER FY NLPEVQKALHANRT+LPY WSMCSGVLNYSD
Sbjct: 295 QQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYSD 354

Query: 241 TDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWF 300
            D NI++LP+LKRII N  P+W+FSGDQDSVVP  GSRTL+RELA+DLNF+ TVPYGAWF
Sbjct: 355 IDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAWF 414

Query: 301 HKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 359
           HK QVGGW  EYG LLTF TVRGAAHMVPYAQPSRALHLFSSFV GRRLPNNT  +  +
Sbjct: 415 HKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE 473
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 Back     alignment and function description
>sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 Back     alignment and function description
>sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 Back     alignment and function description
>sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 Back     alignment and function description
>sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
356518599456 PREDICTED: serine carboxypeptidase-like 1.0 0.787 0.827 1e-180
225457767 467 PREDICTED: serine carboxypeptidase-like 0.997 0.766 0.826 1e-179
255570400 476 serine carboxypeptidase, putative [Ricin 1.0 0.754 0.816 1e-179
356507606455 PREDICTED: serine carboxypeptidase-like 1.0 0.789 0.827 1e-178
356552779 474 PREDICTED: serine carboxypeptidase-like 1.0 0.757 0.830 1e-178
224062940 480 predicted protein [Populus trichocarpa] 1.0 0.747 0.818 1e-178
357491047 470 Serine carboxypeptidase-like protein [Me 0.997 0.761 0.807 1e-176
297795323 473 hypothetical protein ARALYDRAFT_494806 [ 1.0 0.758 0.768 1e-170
15238328 473 serine carboxypeptidase-like 42 [Arabido 1.0 0.758 0.766 1e-169
449532770393 PREDICTED: serine carboxypeptidase-like 1.0 0.913 0.768 1e-167
>gi|356518599|ref|XP_003527966.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/359 (82%), Positives = 326/359 (90%)

Query: 1   MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELF 60
           MSWNKASNLLFVESPAGVGWSYSNTTSDYN GD+STA DM +F++ WY+KFP ++SRELF
Sbjct: 98  MSWNKASNLLFVESPAGVGWSYSNTTSDYNSGDSSTATDMLLFLLKWYQKFPSYRSRELF 157

Query: 61  LTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGM 120
           LTGESYAGHYIPQLA+VLLD+N HS  FKFNIKGVAIGNPLL+LD+D  A YE+FWSHGM
Sbjct: 158 LTGESYAGHYIPQLANVLLDYNVHSTSFKFNIKGVAIGNPLLKLDRDAQATYEYFWSHGM 217

Query: 121 ISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV 180
           ISDEIGL I +DCDFDDYV  ++HNM+ SC EAI EAN+IVGDYINNYDVI DVCYP+IV
Sbjct: 218 ISDEIGLAITNDCDFDDYVFASAHNMSKSCNEAINEANEIVGDYINNYDVIFDVCYPSIV 277

Query: 181 EQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD 240
           EQELRL+K+ATK+S+GVDVCMT ER FY NLPEVQKALHANRTNLPY WSMCSGVLNYSD
Sbjct: 278 EQELRLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQWSMCSGVLNYSD 337

Query: 241 TDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWF 300
           TD NI+ILP+LK+I+QN IPVWVFSGDQDSVVPLLGSRTLIRELA DL F++TVPYGAWF
Sbjct: 338 TDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWF 397

Query: 301 HKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 359
           HK QVGGW TEYGNLLTF TVRGAAHMVPYAQPSRALHLFSSFVHGRRLPN T P+I D
Sbjct: 398 HKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD 456

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457767|ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera] gi|302142765|emb|CBI19968.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570400|ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis] gi|223534536|gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356507606|ref|XP_003522555.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
>gi|356552779|ref|XP_003544740.1| PREDICTED: serine carboxypeptidase-like 42-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224062940|ref|XP_002300939.1| predicted protein [Populus trichocarpa] gi|222842665|gb|EEE80212.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357491047|ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355517146|gb|AES98769.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297795323|ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] gi|297311381|gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238328|ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana] gi|75170531|sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor gi|13605557|gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana] gi|10177009|dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana] gi|23505957|gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana] gi|332007403|gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449532770|ref|XP_004173353.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
TAIR|locus:2157622473 scpl42 "serine carboxypeptidas 1.0 0.758 0.766 1.4e-156
TAIR|locus:2029127479 scpl44 "serine carboxypeptidas 0.997 0.747 0.721 3.4e-148
TAIR|locus:2157612469 scpl41 "serine carboxypeptidas 1.0 0.765 0.696 2.3e-142
TAIR|locus:2051149465 scpl46 "serine carboxypeptidas 0.963 0.744 0.450 2.4e-83
TAIR|locus:2010454461 SCPL45 "serine carboxypeptidas 0.952 0.741 0.450 1.2e-81
TAIR|locus:2060774443 SCPL43 "serine carboxypeptidas 0.509 0.413 0.687 9.9e-71
TAIR|locus:2181504480 scpl35 "serine carboxypeptidas 0.944 0.706 0.386 1.1e-66
TAIR|locus:2039275452 scpl26 "serine carboxypeptidas 0.930 0.738 0.404 1.7e-66
TAIR|locus:2126644479 scpl29 "serine carboxypeptidas 0.966 0.724 0.387 1.7e-66
TAIR|locus:2078598473 scpl25 "serine carboxypeptidas 0.930 0.706 0.415 3.6e-66
TAIR|locus:2157622 scpl42 "serine carboxypeptidase-like 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1526 (542.2 bits), Expect = 1.4e-156, P = 1.4e-156
 Identities = 275/359 (76%), Positives = 312/359 (86%)

Query:     1 MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELF 60
             MSWNKAS+LLFVESPAGVGWSYSN +SDYN GD STA DM VF++ W+EKFP+ KSR+LF
Sbjct:   115 MSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKSTANDMLVFLLRWFEKFPKLKSRDLF 174

Query:    61 LTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGM 120
             LTGESYAGHYIPQLAD +L +N+HS GFKFNIKGVAIGNPLL+LD+D PA YEFFWSHGM
Sbjct:   175 LTGESYAGHYIPQLADAILSYNSHSSGFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGM 234

Query:   121 ISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV 180
             ISDE+ LTI S CDFDDY   + HN++ +C EAI+E   I+ +Y+NNYDV+LDVCYP+IV
Sbjct:   235 ISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIV 294

Query:   181 EQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD 240
             +QELRL+KMATKMS+GVDVCMT ER FY NLPEVQKALHANRT+LPY WSMCSGVLNYSD
Sbjct:   295 QQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYSD 354

Query:   241 TDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWF 300
              D NI++LP+LKRII N  P+W+FSGDQDSVVP  GSRTL+RELA+DLNF+ TVPYGAWF
Sbjct:   355 IDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAWF 414

Query:   301 HKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 359
             HK QVGGW  EYG LLTF TVRGAAHMVPYAQPSRALHLFSSFV GRRLPNNT  +  +
Sbjct:   415 HKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE 473
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0005618 "cell wall" evidence=IDA
TAIR|locus:2029127 scpl44 "serine carboxypeptidase-like 44" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157612 scpl41 "serine carboxypeptidase-like 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051149 scpl46 "serine carboxypeptidase-like 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010454 SCPL45 "serine carboxypeptidase-like 45" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060774 SCPL43 "serine carboxypeptidase-like 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126644 scpl29 "serine carboxypeptidase-like 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FH05SCP42_ARATH3, ., 4, ., 1, 6, ., -0.76601.00.7589yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014292001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (467 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-129
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 3e-30
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 1e-27
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 2e-27
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 2e-27
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 8e-27
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  375 bits (964), Expect = e-129
 Identities = 131/350 (37%), Positives = 186/350 (53%), Gaps = 18/350 (5%)

Query: 2   SWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFL 61
           SWNK +N+LF++ P GVG+SYSNTTSDY   D  TA+D + F+  ++EKFPE+K+   ++
Sbjct: 79  SWNKVANVLFLDQPVGVGFSYSNTTSDYKTDDEETAKDNYEFLQKFFEKFPEYKNNPFYI 138

Query: 62  TGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMI 121
            GESYAGHY+P LA  +LD N    G   N+KGV IGN L        +   F + HG+I
Sbjct: 139 AGESYAGHYVPALAQEILDGNKKGTGPNINLKGVLIGNGLTDPAIQYNSYIPFAYYHGLI 198

Query: 122 SDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDY--INNYDVILDVCYPTI 179
           SDE+  ++   C                C+  + EA+        IN Y++    CY + 
Sbjct: 199 SDELYESLKKACCGKYP---DCDPANTKCLNLVEEASGCNAYNGGINPYNIYTPCCYNSS 255

Query: 180 VEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSG-VLNY 238
               L L   +T    G D         YLN P+V+KALHAN       WS C+  V N+
Sbjct: 256 ----LSLNPSSTDSCGGYDCYDESYVEKYLNRPDVRKALHAN-KGSVGEWSRCNDEVFNW 310

Query: 239 SDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGA 298
              D + ++LP+L ++++ G+ V ++SGD D +   LG++  I      LN+     +  
Sbjct: 311 YGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQAWIDA----LNWSGKDGFRP 366

Query: 299 WFHK--QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG 346
           W+     QV G+   YGN LTF TV+GA HMVP  QP  AL +F  F+ G
Sbjct: 367 WYVSVDGQVAGYVKSYGN-LTFATVKGAGHMVPEDQPEAALQMFKRFLSG 415

Length = 415
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PLN02209437 serine carboxypeptidase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
PRK03204286 haloalkane dehalogenase; Provisional 98.74
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.55
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.5
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.49
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.46
PHA02857276 monoglyceride lipase; Provisional 98.45
PLN02824294 hydrolase, alpha/beta fold family protein 98.43
PRK00870302 haloalkane dehalogenase; Provisional 98.39
PRK10673255 acyl-CoA esterase; Provisional 98.39
PLN02385349 hydrolase; alpha/beta fold family protein 98.35
PLN02679360 hydrolase, alpha/beta fold family protein 98.34
PLN02298330 hydrolase, alpha/beta fold family protein 98.31
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.26
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.26
PRK03592295 haloalkane dehalogenase; Provisional 98.25
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.21
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 98.19
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.09
PLN02578354 hydrolase 98.09
PRK10749330 lysophospholipase L2; Provisional 98.08
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.01
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.97
PLN02652395 hydrolase; alpha/beta fold family protein 97.94
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 97.94
PLN02894402 hydrolase, alpha/beta fold family protein 97.85
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.79
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.61
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.59
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 97.59
PLN02511388 hydrolase 97.37
KOG1455313 consensus Lysophospholipase [Lipid transport and m 97.18
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.15
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 96.8
PRK10349256 carboxylesterase BioH; Provisional 96.73
PRK07581339 hypothetical protein; Validated 96.45
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.37
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.36
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.34
PLN02965255 Probable pheophorbidase 96.07
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.04
PRK08775343 homoserine O-acetyltransferase; Provisional 96.0
PLN02965255 Probable pheophorbidase 95.83
PRK10349256 carboxylesterase BioH; Provisional 95.74
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.74
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 95.7
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 95.65
PRK00175379 metX homoserine O-acetyltransferase; Provisional 95.52
PLN02211273 methyl indole-3-acetate methyltransferase 95.29
PRK06765389 homoserine O-acetyltransferase; Provisional 95.23
PRK05077414 frsA fermentation/respiration switch protein; Revi 95.18
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 94.86
PRK06489360 hypothetical protein; Provisional 94.68
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 94.45
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.43
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 94.41
COG2267298 PldB Lysophospholipase [Lipid metabolism] 93.26
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 92.96
PRK08775343 homoserine O-acetyltransferase; Provisional 92.67
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 92.18
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 92.14
PRK06489360 hypothetical protein; Provisional 92.05
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 91.85
PRK10566249 esterase; Provisional 91.32
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 91.19
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 90.55
PLN02454414 triacylglycerol lipase 90.38
PRK11460232 putative hydrolase; Provisional 90.37
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 90.33
PRK05855 582 short chain dehydrogenase; Validated 90.0
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 89.72
PRK05855 582 short chain dehydrogenase; Validated 89.55
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 89.31
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 88.9
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 88.79
PRK10566249 esterase; Provisional 88.65
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 88.63
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 88.49
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 88.37
PRK13604307 luxD acyl transferase; Provisional 88.36
PLN02442283 S-formylglutathione hydrolase 88.15
PRK07581339 hypothetical protein; Validated 88.02
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 87.89
KOG2382315 consensus Predicted alpha/beta hydrolase [General 87.88
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 87.43
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 87.39
PLN02211273 methyl indole-3-acetate methyltransferase 87.22
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 86.9
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 85.81
PLN02872395 triacylglycerol lipase 85.76
KOG2564343 consensus Predicted acetyltransferases and hydrola 85.66
COG0400207 Predicted esterase [General function prediction on 85.32
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 85.11
PRK10162318 acetyl esterase; Provisional 84.72
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 84.45
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 84.41
PF10081289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 84.2
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 83.4
KOG2183492 consensus Prolylcarboxypeptidase (angiotensinase C 83.08
PLN02571413 triacylglycerol lipase 83.0
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 82.65
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 82.42
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 81.73
PRK10985324 putative hydrolase; Provisional 81.59
PRK00175379 metX homoserine O-acetyltransferase; Provisional 81.49
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 81.24
KOG1838409 consensus Alpha/beta hydrolase [General function p 81.23
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 80.05
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-89  Score=653.49  Aligned_cols=340  Identities=43%  Similarity=0.791  Sum_probs=295.8

Q ss_pred             CCcccccceEEEeCCCCcccccccCCCCCCCCchHhHHHHHHHHHHHHHHCCCCCCCceEEEcccccceehHHHHHHHHh
Q 018203            1 MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLD   80 (359)
Q Consensus         1 ysW~~~anvlfiDqPvG~GFSy~~~~~~~~~~~~~~a~d~~~fL~~F~~~fP~~~~~~~yi~GESYgG~yvP~la~~i~~   80 (359)
                      |||||.||||||||||||||||+++++++.++|+.+|+|++.||+.||++||||++|||||+||||||||||+||++|++
T Consensus       112 ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~YVP~La~~I~~  191 (454)
T KOG1282|consen  112 YSWNKEANILFLDQPVGVGFSYSNTSSDYKTGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGHYVPALAQEILK  191 (454)
T ss_pred             ccccccccEEEEecCCcCCccccCCCCcCcCCcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccccceehHHHHHHHHh
Confidence            79999999999999999999999999888889999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCceeeeeEeEecCCcCCCCCCchhhHHHHHHcCCCCHHHHHHHhccCCCCCccCCCCCCCCchHHHHHHHHHHH
Q 018203           81 HNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKI  160 (359)
Q Consensus        81 ~n~~~~~~~inLkGi~IGng~~~p~~~~~~~~~~~~~~gli~~~~~~~~~~~c~~~~~~~~~~~~~~~~C~~~~~~~~~~  160 (359)
                      .|+....+.|||||++||||++|+..|..++.+|++.||+|++++++.+++.|......-......+..|..++++....
T Consensus       192 ~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~  271 (454)
T KOG1282|consen  192 GNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNTKCNKAVEEFDSK  271 (454)
T ss_pred             ccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchhHHHHHHHHHHHH
Confidence            99754456899999999999999999999999999999999999999999999865321111113356899999998855


Q ss_pred             hcCCCCccccccccCCCchHHHHHHHhhhhhccccCcccccchhhHhhcCchHHHHhhCCCCCCCccccccccccccccC
Q 018203          161 VGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD  240 (359)
Q Consensus       161 ~~~~~~~yd~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~V~~aL~v~~~~~~~~w~~cs~~~~~~~  240 (359)
                      ....++.|++..+.|.......      .....+...++|.+...+.|||+++||+||||+....| +|+.||..+....
T Consensus       272 ~~~~i~~y~i~~~~C~~~~~~~------~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~~-~W~~Cn~~v~~~~  344 (454)
T KOG1282|consen  272 TTGDIDNYYILTPDCYPTSYEL------KKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSIG-KWERCNDEVNYNY  344 (454)
T ss_pred             HhccCchhhhcchhhccccccc------cccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCCC-cccccChhhhccc
Confidence            5447889998888897511100      00112345688987666899999999999999875544 8999999987656


Q ss_pred             CCCCCChHHHHHHHHhCC-ccEEEEecCCCcccCchhHHHHHHHHHHhcCCCcccccccceeC-CeeeEEEEEeCCeeEE
Q 018203          241 TDSNINILPVLKRIIQNG-IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHK-QQVGGWGTEYGNLLTF  318 (359)
Q Consensus       241 ~d~~~~~~~~l~~LL~~~-irVLiy~Gd~D~~~~~~G~~~~i~~l~~~~~~~~~~~~~~w~~~-~~~~G~~k~~~n~Ltf  318 (359)
                      .+...++++.+..++..+ +|||||+||.|++||+.||++||+.|    +++...+|+||+.+ +|+|||+++|++ |+|
T Consensus       345 ~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~L----~~~~~~~~~pW~~~~~qvaG~~~~Y~~-ltf  419 (454)
T KOG1282|consen  345 NDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKSL----NLSITDEWRPWYHKGGQVAGYTKTYGG-LTF  419 (454)
T ss_pred             ccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHhc----cCccccCccCCccCCCceeeeEEEecC-EEE
Confidence            666678999999999855 99999999999999999999999987    57778999999995 899999999999 999


Q ss_pred             EEEcCCCCCCCCCChHHHHHHHHHHhcCCCCCCC
Q 018203          319 VTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNN  352 (359)
Q Consensus       319 ~~V~~AGHmvP~dqP~~a~~mi~~fl~~~~~~~~  352 (359)
                      +||+|||||||.|||++|++||++||.|++++..
T Consensus       420 ~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l~~~  453 (454)
T KOG1282|consen  420 ATVRGAGHMVPYDKPESALIMFQRFLNGQPLPST  453 (454)
T ss_pred             EEEeCCcccCCCCCcHHHHHHHHHHHcCCCCCCC
Confidence            9999999999999999999999999999999764

>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 1e-30
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 1e-30
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 1e-30
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 1e-30
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 1e-30
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 7e-28
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 8e-27
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 6e-26
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 5e-25
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 7e-25
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 7e-25
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 2e-20
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 1e-18
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 5e-18
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 1e-17
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 5e-08
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 105/174 (60%), Gaps = 11/174 (6%)
Query: 3   WNKASNLLFVESPAGVGWSYSNTTSD-YNCGDASTARDMHVFMMNWYEKFPEFKSRELFL 61
           WNK +N+LF++SPAGVG+SY+NT+SD Y  GD  TA D + F+  W+E+FP +K R+ ++
Sbjct: 95  WNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYI 154
Query: 62  TGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMI 121
            GESYAGHY+P+L+ ++      SK    N+KG  +GN L+    D    +EF+W+HG++
Sbjct: 155 AGESYAGHYVPELSQLV----HRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIV 210
Query: 122 SDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVC 175
           SD+    +   C  D ++     + + +C  A   A    G+ I+ Y +   VC
Sbjct: 211 SDDTYRRLKEACLHDSFI-----HPSPACDAATDVATAEQGN-IDMYSLYTPVC 258
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-121
1ivy_A452 Human protective protein; carboxypeptidase, serine 1e-120
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-111
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 2e-67
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 3e-67
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 9e-58
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 1e-57
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
 Score =  357 bits (918), Expect = e-121
 Identities = 83/392 (21%), Positives = 154/392 (39%), Gaps = 52/392 (13%)

Query: 2   SWNKASNLLFVESPAGVGWSYSNTTSDYNCGDAS-------TARDMHVFMMNWYEKFPEF 54
           SW    +LLF++ P G G+S      +                +    F+ N+++ FPE 
Sbjct: 106 SWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPED 165

Query: 55  KSRELFLTGESYAGHYIPQLADVLLDHNAHSK--GFKFNIKGVAIGNPLLRLDQDVPAIY 112
            +R++ L+GESYAG YIP  A+ +L+HN  SK  G  +++K + IGN  +  +    +  
Sbjct: 166 LTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYL 225

Query: 113 EFFWSHGMISDEIG-----LTIMSDC----------DFDDYVSGTSHNMTNSCIEAITE- 156
            F     +I +             +C          +   +      N+ N  +    E 
Sbjct: 226 PFAMEKKLIDESNPNFKHLTNAHENCQNLINSASTDEAAHFSYQECENILNLLLSYTRES 285

Query: 157 ANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQK 216
           + K   D +N Y+  L   YP+      +     +K               + + P V  
Sbjct: 286 SQKGTADCLNMYNFNLKDSYPSCGMNWPKDISFVSK---------------FFSTPGVID 330

Query: 217 ALHANRTNLPYGWSMCSGVLNYS-DTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLL 275
           +LH +   + + W  C+  +        +   + +L  ++++GI + +F+GD+D +    
Sbjct: 331 SLHLDSDKIDH-WKECTNSVGTKLSNPISKPSIHLLPGLLESGIEIVLFNGDKDLICNNK 389

Query: 276 GSRTLIRELA--RDLNFEVTVPYGAWFHK-------QQVGGWGTEYGNLLTFVTVRGAAH 326
           G    I  L       F        W HK       ++  G+     N LTFV+V  A+H
Sbjct: 390 GVLDTIDNLKWGGIKGFSDDAVSFDWIHKSKSTDDSEEFSGYVKYDRN-LTFVSVYNASH 448

Query: 327 MVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQ 358
           MVP+ +   +  +   + +   + +N    + 
Sbjct: 449 MVPFDKSLVSRGIVDIYSNDVMIIDNNGKNVM 480
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.67
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.62
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.61
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.57
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.57
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.5
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.49
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.41
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.41
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.39
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.34
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.33
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.33
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.32
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.31
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.31
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.31
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.3
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.3
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.29
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.29
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.28
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.26
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.25
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.25
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.24
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.23
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.23
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.23
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.21
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.2
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.16
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.16
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.16
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.16
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.15
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.15
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.13
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.11
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.1
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.09
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.09
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.09
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.07
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.04
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.02
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.01
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.98
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.96
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.95
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.94
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 97.93
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.91
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.91
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.84
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.8
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 97.77
3h04_A275 Uncharacterized protein; protein with unknown func 97.74
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.68
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 97.65
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.58
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.35
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.32
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 97.1
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.03
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 96.99
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 96.95
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.92
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.83
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.83
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.82
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.8
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 96.75
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 96.75
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.74
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 96.73
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 96.7
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 96.68
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.65
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.63
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.61
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.59
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.57
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.55
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 96.55
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.54
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.52
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.51
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.5
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.46
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 96.45
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 96.45
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 96.44
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 96.41
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 96.39
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.37
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 96.37
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 96.36
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.34
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.34
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.32
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.32
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.31
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.3
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.27
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 96.2
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 96.18
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.16
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.16
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.16
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.07
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.06
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.04
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.0
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.0
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.96
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.93
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 95.92
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 95.89
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 95.89
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.85
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.85
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.84
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 95.83
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 95.81
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.75
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.72
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.65
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 95.54
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 95.47
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 95.36
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 95.3
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 95.29
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.27
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.15
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 95.03
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 94.92
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 94.78
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 94.78
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 93.76
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 94.73
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.7
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 94.64
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 94.62
1vkh_A273 Putative serine hydrolase; structural genomics, jo 94.43
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 94.42
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 94.37
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.36
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 94.35
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.35
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 94.33
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.24
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.1
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 94.04
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.02
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 93.06
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 93.96
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 93.96
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.91
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 93.88
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 93.87
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 93.81
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 93.74
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 93.65
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 93.63
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 93.6
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 93.55
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 93.53
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 93.53
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 93.47
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 93.45
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 93.23
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 93.19
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 93.16
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.12
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 93.1
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.07
4f21_A246 Carboxylesterase/phospholipase family protein; str 93.07
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 93.01
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.0
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 92.92
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 92.86
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 92.77
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 92.48
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 92.34
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 92.31
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 92.3
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 92.24
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 92.24
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 92.15
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 92.02
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 91.93
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 91.68
3bjr_A283 Putative carboxylesterase; structural genomics, jo 91.67
3ain_A323 303AA long hypothetical esterase; carboxylesterase 91.46
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 91.45
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 91.4
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 91.31
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 91.3
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 91.18
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 91.14
4fle_A202 Esterase; structural genomics, PSI-biology, northe 91.0
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 91.0
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 90.99
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 90.84
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 90.76
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 90.75
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 90.7
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 90.63
1kez_A300 Erythronolide synthase; polyketide synthase, modul 90.6
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 90.41
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 90.29
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 90.21
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 90.09
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 90.09
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 89.95
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 89.79
4ebb_A472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 89.77
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 89.66
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 89.61
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 89.57
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.48
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 89.46
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 89.41
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 89.35
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 89.29
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 89.06
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 88.95
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 88.94
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 88.93
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 88.86
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 88.72
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 88.61
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 88.49
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 88.48
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 88.08
1vkh_A273 Putative serine hydrolase; structural genomics, jo 88.05
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 87.98
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 87.85
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 87.85
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 87.84
3bjr_A283 Putative carboxylesterase; structural genomics, jo 87.66
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 87.01
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 87.0
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 86.88
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.77
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 86.63
3tej_A329 Enterobactin synthase component F; nonribosomal pe 86.57
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 86.53
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 86.53
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 86.49
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 86.27
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 86.18
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 86.11
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 86.1
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 86.0
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 85.97
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 85.71
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 85.43
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 85.32
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 85.3
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 85.28
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 85.17
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 85.13
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 84.96
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 84.86
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 84.78
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 84.69
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 84.66
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 84.61
1kez_A300 Erythronolide synthase; polyketide synthase, modul 84.6
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 84.59
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 84.51
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 84.46
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 84.4
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 84.17
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 84.05
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 83.95
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 83.95
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 83.74
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 83.73
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 83.39
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 82.91
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 82.87
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 82.82
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 82.66
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 82.4
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 82.39
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 82.36
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 82.15
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 81.83
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 81.62
3lp5_A250 Putative cell surface hydrolase; structural genom 81.21
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 80.75
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 80.29
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 80.21
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 80.12
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=2.6e-79  Score=600.76  Aligned_cols=325  Identities=24%  Similarity=0.437  Sum_probs=269.1

Q ss_pred             CCcccccceEEEeCCCCcccccccCCCC-------CCCCchHhHHHHHHHHHHHHHHCCCCCCCceEEEcccccceehHH
Q 018203            1 MSWNKASNLLFVESPAGVGWSYSNTTSD-------YNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQ   73 (359)
Q Consensus         1 ysW~~~anvlfiDqPvG~GFSy~~~~~~-------~~~~~~~~a~d~~~fL~~F~~~fP~~~~~~~yi~GESYgG~yvP~   73 (359)
                      |||++.|||||||||+||||||+....+       +..+++++|++++.||+.||++||+|++++|||+||||||||||.
T Consensus       105 ~sw~~~~n~lfiDqPvGtGfSy~~~~~~~~~~~~~~~~~~~~~a~~~~~fl~~~~~~fP~~~~~~~~i~GeSYgg~y~p~  184 (483)
T 1ac5_A          105 GSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPF  184 (483)
T ss_dssp             TCGGGTSEEEEECCSTTSTTCSSCCSSGGGSCTTSSCCSHHHHHHHHHHHHHHHHHHCTTGGGSEEEEEEEETHHHHHHH
T ss_pred             cchhhcCCeEEEecCCCccccCCcCcccccccccccCCCHHHHHHHHHHHHHHHHHhChhhcCCCEEEEeccccccccHH
Confidence            7999999999999999999999876543       556788999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhcCC--CCceeeeeEeEecCCcCCCCCCchhhHHHHHHcCCCCHHH--HHHHh---ccCCCCCccCCC----
Q 018203           74 LADVLLDHNAHS--KGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEI--GLTIM---SDCDFDDYVSGT----  142 (359)
Q Consensus        74 la~~i~~~n~~~--~~~~inLkGi~IGng~~~p~~~~~~~~~~~~~~gli~~~~--~~~~~---~~c~~~~~~~~~----  142 (359)
                      ||.+|+++|+..  ....||||||+|||||+||..|..++.+|++.+|+|++++  ++.+.   +.|..  +....    
T Consensus       185 ~a~~i~~~n~~~~~~~~~inLkGi~IGNg~~d~~~~~~~~~~f~~~~gli~~~~~~~~~~~~~~~~C~~--~i~~~~~~~  262 (483)
T 1ac5_A          185 FANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHENCQN--LINSASTDE  262 (483)
T ss_dssp             HHHHHHHHHHHCCSTTSCCEEEEEEEEEECCCHHHHHTTHHHHHHHTTSCCTTSTTHHHHHHHHHHHHH--HHHHCCSGG
T ss_pred             HHHHHHHhcccccccCcccceeeeEecCCcccchhhhccHHHHHHhCCCCCccHHHHHHHHHHHHHHHH--HHHhccccc
Confidence            999999998753  2357999999999999999999999999999999999875  55543   36641  11000    


Q ss_pred             -CCCCCchHHHHHHHHHHHhc--------CCCCccccccccCCCchHHHHHHHhhhhhccccCcccccc------hhhHh
Q 018203          143 -SHNMTNSCIEAITEANKIVG--------DYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMT------LERFF  207 (359)
Q Consensus       143 -~~~~~~~C~~~~~~~~~~~~--------~~~~~yd~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~c~~------~~~~~  207 (359)
                       .......|.++++.+...+.        .++|.||++.. |                    ..+.|..      ..+..
T Consensus       263 ~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~c~n~ydi~~~-~--------------------~~~~c~~~~~~~~~~~~~  321 (483)
T 1ac5_A          263 AAHFSYQECENILNLLLSYTRESSQKGTADCLNMYNFNLK-D--------------------SYPSCGMNWPKDISFVSK  321 (483)
T ss_dssp             GGSSSCHHHHTHHHHHHHHTCCCCTTSTTSEEETTEEEEE-E--------------------CTTTTTTTCCTHHHHHHH
T ss_pred             cccccHHHHHHHHHHHHHHhhcccccccccCccccccccc-C--------------------CCCCcccccccchhHHHH
Confidence             01224579888887764332        24556665432 1                    1123321      24789


Q ss_pred             hcCchHHHHhhCCCCCCCccccccccccccccC-CCCCCChHHHHHHHHhCCccEEEEecCCCcccCchhHHHHHHHHHH
Q 018203          208 YLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD-TDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELAR  286 (359)
Q Consensus       208 ylN~~~V~~aL~v~~~~~~~~w~~cs~~~~~~~-~d~~~~~~~~l~~LL~~~irVLiy~Gd~D~~~~~~G~~~~i~~l~~  286 (359)
                      |||+++||+||||+...+ .+|+.||..+...+ .|.+.|+.+.++.||++|+|||||+||.|++||+.|+++|+++|+|
T Consensus       322 ylN~~~Vq~ALhv~~~~~-~~w~~Cs~~V~~~~~~d~~~~~~~~l~~LL~~girVLIYsGD~D~icn~~Gt~~~i~~L~W  400 (483)
T 1ac5_A          322 FFSTPGVIDSLHLDSDKI-DHWKECTNSVGTKLSNPISKPSIHLLPGLLESGIEIVLFNGDKDLICNNKGVLDTIDNLKW  400 (483)
T ss_dssp             HHTSTTHHHHTTCCTTTC-CCCCSBCHHHHHHCCCSSCCCGGGGHHHHHHTTCEEEEEEETTCSTTCHHHHHHHHHHCEE
T ss_pred             HhCCHHHHHHhCCCCCCC-CCeeeCchhHHHHhcCCCcCcHHHHHHHHHhcCceEEEEECCcCcccCcHHHHHHHHhcCc
Confidence            999999999999986433 37999999886544 6678899999999999999999999999999999999999999997


Q ss_pred             h--cCCCcccccccceeCC-------eeeEEEEEeCCeeEEEEEcCCCCCCCCCChHHHHHHHHHHhcCCCCC
Q 018203          287 D--LNFEVTVPYGAWFHKQ-------QVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLP  350 (359)
Q Consensus       287 ~--~~~~~~~~~~~w~~~~-------~~~G~~k~~~n~Ltf~~V~~AGHmvP~dqP~~a~~mi~~fl~~~~~~  350 (359)
                      .  .+|....+|++|+.++       +++||+|+++| |||++|++||||||+|||++|++||++||.+.++.
T Consensus       401 ~g~~~f~~~~~~~~W~~~~~~~~~~~~vaG~vk~~~n-LTFvtV~gAGHmVP~dqP~~al~m~~~fl~~~~l~  472 (483)
T 1ac5_A          401 GGIKGFSDDAVSFDWIHKSKSTDDSEEFSGYVKYDRN-LTFVSVYNASHMVPFDKSLVSRGIVDIYSNDVMII  472 (483)
T ss_dssp             TTEESSCTTCEEEEEEECSSTTCCCCSCCEEEEEETT-EEEEEETTCCSSHHHHCHHHHHHHHHHHTTCCEEE
T ss_pred             ccccccccCCCceeeEECCccccCccccceEEEEecC-eEEEEECCccccCcchhHHHHHHHHHHHHCCcccc
Confidence            5  4677666789998876       89999999999 99999999999999999999999999999999874
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 1e-76
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 2e-76
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 5e-76
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-72
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 9e-65
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.8
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.75
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.72
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.7
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.69
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.65
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.6
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.57
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.55
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.5
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.48
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.46
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.43
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.38
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.15
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.07
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.05
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.87
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.23
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 96.99
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 96.96
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 96.92
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 96.79
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.44
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.0
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 95.72
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.64
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.56
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 95.31
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.23
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 95.0
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 94.77
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.25
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 94.14
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.94
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 93.63
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 93.6
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 92.33
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 92.32
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 91.83
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 91.63
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 91.52
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 90.55
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 90.39
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 90.13
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 89.99
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 89.35
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 89.23
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 88.91
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 88.89
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 88.7
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 88.48
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 88.45
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 87.83
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 87.45
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 87.44
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 87.32
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 86.56
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 85.84
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 85.76
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 85.66
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 85.4
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 84.91
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 84.76
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 84.67
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 84.28
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 84.16
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 84.04
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 83.98
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 83.97
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 83.3
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 82.97
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 82.46
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 82.05
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 82.04
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 81.31
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 81.03
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 80.33
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 80.22
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure