BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018262
(359 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3KD4|A Chain A, Crystal Structure Of A Putative Protease (Bdi_1141) From
Parabacteroides Distasonis Atcc 8503 At 2.00 A
Resolution
pdb|3KD4|B Chain B, Crystal Structure Of A Putative Protease (Bdi_1141) From
Parabacteroides Distasonis Atcc 8503 At 2.00 A
Resolution
Length = 506
Score = 28.9 bits (63), Expect = 4.2, Method: Compositional matrix adjust.
Identities = 14/43 (32%), Positives = 23/43 (53%)
Query: 269 SRTFVPTGHEMDAVRRNKLDEIQLSSVSSSDASTPKHSSTMPD 311
+RT P G+ ++ VR +L++ Q + SD + H T PD
Sbjct: 456 TRTITPRGNTIEVVRTIELNKQQFTPAEYSDVRSLIHEWTNPD 498
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.139 0.428
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,155,329
Number of Sequences: 62578
Number of extensions: 391086
Number of successful extensions: 741
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 740
Number of HSP's gapped (non-prelim): 1
length of query: 359
length of database: 14,973,337
effective HSP length: 100
effective length of query: 259
effective length of database: 8,715,537
effective search space: 2257324083
effective search space used: 2257324083
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)