BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018353
         (357 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae
            (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1
          Length = 3744

 Score = 35.0 bits (79), Expect = 0.87,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 199  GRKQPWDIIQDMNNTYKDMNRLVAYSKALNTWAKWVNSNVDNSKTKVIFRGIS 251
            GR+QPW+ +Q++NN  K    L+A S  L +    +N    ++  + +FR I+
Sbjct: 3200 GRRQPWEYLQELNNILKTAYPLLALS--LESLVAQINDRFKSTTDEDLFRLIN 3250


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.137    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 145,189,148
Number of Sequences: 539616
Number of extensions: 6327929
Number of successful extensions: 11901
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 11901
Number of HSP's gapped (non-prelim): 5
length of query: 357
length of database: 191,569,459
effective HSP length: 119
effective length of query: 238
effective length of database: 127,355,155
effective search space: 30310526890
effective search space used: 30310526890
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)