BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018353
(357 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae
(strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1
Length = 3744
Score = 35.0 bits (79), Expect = 0.87, Method: Composition-based stats.
Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
Query: 199 GRKQPWDIIQDMNNTYKDMNRLVAYSKALNTWAKWVNSNVDNSKTKVIFRGIS 251
GR+QPW+ +Q++NN K L+A S L + +N ++ + +FR I+
Sbjct: 3200 GRRQPWEYLQELNNILKTAYPLLALS--LESLVAQINDRFKSTTDEDLFRLIN 3250
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.137 0.450
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 145,189,148
Number of Sequences: 539616
Number of extensions: 6327929
Number of successful extensions: 11901
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 11901
Number of HSP's gapped (non-prelim): 5
length of query: 357
length of database: 191,569,459
effective HSP length: 119
effective length of query: 238
effective length of database: 127,355,155
effective search space: 30310526890
effective search space used: 30310526890
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)