BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018370
         (357 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KE3|A Chain A, Crystal Structure Of Putative Serine-Pyruvate
           Aminotransferase (Yp_263484.1) From Psychrobacter
           Arcticum 273-4 At 2.20 A Resolution
          Length = 379

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 297 IDPGGIANRSVTHVDWSERKWHPKSYKRSDVSYDLLKNITSVYLSE 342
           IDP G+   SV + D   R  +  S    +V  DLL N+ +VY +E
Sbjct: 9   IDPNGLLEYSVVYTD---RALNHXSKAFQEVXNDLLSNLKTVYNAE 51


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,732,462
Number of Sequences: 62578
Number of extensions: 497985
Number of successful extensions: 1083
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1083
Number of HSP's gapped (non-prelim): 2
length of query: 357
length of database: 14,973,337
effective HSP length: 100
effective length of query: 257
effective length of database: 8,715,537
effective search space: 2239893009
effective search space used: 2239893009
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)