Citrus Sinensis ID: 018378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MAEREETEKKKEAESFSIWDLPDVPQKLPPHIEFQRTRVQCNLDAPIHTENVMYSGAYASMGVDNSLQLDHFCNNFRVEVIRLTKDDMEFDLIGIDAAIANAFRRILIAELPTMAIEKVLIANNTSVIQDEVLAHRLGLIPIIVDPRLFEYMSENDTSNEKNTIVFKLHVLCERGGPRLTVKTNELKWLPNGSELPLETKPDSNPSSKPRTYTSFSSSQDLLPEFSNNPIRPMLDITIARLGPGQEIELEAHAVKGIGKTHAKWSPVATAWYRMLPEIVLLEDVEDEDAEKLVKTCPVNVFDIEDIGSGKKRATVAQPRACTLCRECLRCGEEWEKRVSIRRVKDHFICKYVMLIIN
ccHHHHHHHHHHcccccccccccccccccccHHHcccEEEEcccccccccccccccccccccccccccHHHHHcccEEEEEEccccCEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEEEEccccccHHHHHHHHccccCECcccccccccccccccccccEEEEEEEEECccccCEEECccccccccccccccccccccccccccccEEccccccccccccccccccccccccEEEEcccccEEEEEEEEEEcccccccccccEEEEEEEEccEEEEEccccHHHHHHHHHHccccEEEEcccccccEEEEEcccccccHHHHHHHccccccccEEEEEEccEEEEEEEEEEEc
****************SIWDLPDVPQKLPPHIEFQRTRVQCNLDAPIHTENVMYSGAYASMGVDNSLQLDHFCNNFRVEVIRLTKDDMEFDLIGIDAAIANAFRRILIAELPTMAIEKVLIANNTSVIQDEVLAHRLGLIPIIVDPRLFEYMSENDTSNEKNTIVFKLHVLCERGGPRLTVKTNELKWLPNGSELPLETKPDSNPSSKPRTYT***********FSNNPIRPMLDITIARLGPGQEIELEAHAVKGIGKTHAKWSPVATAWYRMLPEIVLLEDVEDEDAEKLVKTCPVNVFDIEDIGSGKKRATVAQPRACTLCRECLRCGEEWEKRVSIRRVKDHFICKYVMLIIN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEREETEKKKEAESFSIWDLPDVPQKLPPHIEFQRTRVQCNLDAPIHTENVMYSGAYASMGVDNSLQLDHFCNNFRVEVIRLTKDDMEFDLIGIDAAIANAFRRILIAELPTMAIEKVLIANNTSVIQDEVLAHRLGLIPIIVDPRLFEYMSENDTSNEKNTIVFKLHVLCERGGPRLTVKTNELKWLPNGSELPLETKPDSNPSSKPRTYTSFSSSQDLLPEFSNNPIRPMLDITIARLGPGQEIELEAHAVKGIGKTHAKWSPVATAWYRMLPEIVLLEDVEDEDAEKLVKTCPVNVFDIEDIGSGKKRATVAQPRACTLCRECLRCGEEWEKRVSIRRVKDHFICKYVMLIIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.probableQ32L22
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.probableO94616
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.probableP52432

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PA8, chain D
Confidence level:very confident
Coverage over the Query: 77-189,227-353
View the alignment between query and template
View the model in PyMOL
Template: 2WAQ, chain D
Confidence level:probable
Coverage over the Query: 83-160,172-186,207-348
View the alignment between query and template
View the model in PyMOL