BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018387
(357 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione
S-transferase From Housefly, Musca Domestica
pdb|3VWX|B Chain B, Structural Analysis Of An Epsilon-class Glutathione
S-transferase From Housefly, Musca Domestica
pdb|3VWX|C Chain C, Structural Analysis Of An Epsilon-class Glutathione
S-transferase From Housefly, Musca Domestica
pdb|3VWX|D Chain D, Structural Analysis Of An Epsilon-class Glutathione
S-transferase From Housefly, Musca Domestica
Length = 222
Score = 28.5 bits (62), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 17/31 (54%)
Query: 138 PIAPTKECIQLVKELAAPVEYIILPTFAYEH 168
P P + C+ +K L P EY ++ FA EH
Sbjct: 11 PSPPVRACLLTLKALNLPFEYKVVNLFAKEH 41
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.134 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,008,312
Number of Sequences: 62578
Number of extensions: 331587
Number of successful extensions: 582
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 581
Number of HSP's gapped (non-prelim): 1
length of query: 357
length of database: 14,973,337
effective HSP length: 100
effective length of query: 257
effective length of database: 8,715,537
effective search space: 2239893009
effective search space used: 2239893009
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)