Citrus Sinensis ID: 018394


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MYQGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVDRGGCTVEDFCNHIHRSLVKDVKYVLVWGTSARHYPQHCGLGHVLQDEDVVQIVKKKEKEEGGRGRFKSHSNAPARISDREKKAPLKT
cccccccccccEEEEECccEEEEEEccccccHHHHHHHHcccccccccccccccccccCEEEEccCEEEEECccccccccccccccccEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHcccccccccccEEEEEccccccEEccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHccccCEEEEccccccHHHHHHHHHHHccEEEEEcccccccccccccEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccEEccccEEEEEEEcccccccccccccccccccccccccccccccc
***********FEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVDRGGCTVEDFCNHIHRSLVKDVKYVLVWGTSARHYPQHCGLGHVLQDEDVVQIVK*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVDRGGCTVEDFCNHIHRSLVKDVKYVLVWGTSARHYPQHCGLGHVLQDEDVVQIVKKKEKEEGGRGRFKSHSNAPARISDREKKAPLKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Developmentally regulated G-protein 2 Binds GDP and GTP, and has low GTPase activity.confidentQ9CAI1
Developmentally regulated G-protein 1 Binds GDP and GTP, and has low GTPase activity. May interact with phosphatidic acid (PA).confidentQ9LQK0
Developmentally-regulated GTP-binding protein 2 May play a role in cell proliferation, differentiation and death.probableQ58D56

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A9A, chain A
Confidence level:very confident
Coverage over the Query: 7-324
View the alignment between query and template
View the model in PyMOL