Citrus Sinensis ID: 018423


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MLSFPVTPSLLNHSHLLHHRPYFSFTVRSSSSSSAVQEVEESSKSTADAGELSSELYVSPPFPQIRAAKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILAHESKSVLVVAHNAVNQALVATAIGLGTGFFRILLQSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNSPVAAGSSGGRKASKRIILVCYGTTQGDSEASVAYSAEQPMNMLGIIQAQKTAELLLDLNVSSIVSSPKNACVQTAEAISRVSS
cccccccccccccccccccccccccCECcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccECcccccccccHHHHHHHHHHHHHHHcccccEEECcccHHHHHHHHHHHHccccccCCcccEEEccccccccccHHHHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHcccccccccccccccCEEEEEECcccccccccCEEEccccccccccccccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcc
***********NHSHLLHHRPYFSFTVRSSS******************************FPQIRAAKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILAHESKSVLVVAHNAVNQALVATAIGLGTGFFRILLQSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNSPVAAGSSGGRKASKRIILVCYGTTQGDSEASVAYSAEQPMNMLGIIQAQKTAELLLDLNVSSIVSSPKNACVQTAEAISRVS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSFPVTPSLLNHSHLLHHRPYFSFTVRSSSSSSAVQEVEESSKSTADAGELSSELYVSPPFPQIRAAKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILAHESKSVLVVAHNAVNQALVATAIGLGTGFFRILLQSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNSPVAAGSSGGRKASKRIILVCYGTTQGDSEASVAYSAEQPMNMLGIIQAQKTAELLLDLNVSSIVSSPKNACVQTAEAISRVSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E9C, chain A
Confidence level:very confident
Coverage over the Query: 67-79,92-154,188-273
View the alignment between query and template
View the model in PyMOL
Template: 3E9C, chain A
Confidence level:very confident
Coverage over the Query: 286-297,310-354
View the alignment between query and template
View the model in PyMOL