Citrus Sinensis ID: 018441
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| 224132056 | 518 | predicted protein [Populus trichocarpa] | 0.988 | 0.679 | 0.770 | 1e-150 | |
| 449456094 | 514 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.682 | 0.740 | 1e-149 | |
| 255585855 | 462 | phosphoglycerate mutase, putative [Ricin | 0.851 | 0.655 | 0.838 | 1e-147 | |
| 297734844 | 529 | unnamed protein product [Vitis vinifera] | 0.952 | 0.640 | 0.742 | 1e-144 | |
| 359479415 | 509 | PREDICTED: uncharacterized protein LOC10 | 0.952 | 0.666 | 0.742 | 1e-144 | |
| 147803507 | 1073 | hypothetical protein VITISV_033681 [Viti | 0.890 | 0.295 | 0.773 | 1e-142 | |
| 353227769 | 509 | 2-carboxy-D-arabinitol 1-phosphate (CA1P | 0.935 | 0.654 | 0.701 | 1e-137 | |
| 371782085 | 508 | 2-carboxy-D-arabinitol 1-phosphate (CA1P | 0.924 | 0.647 | 0.711 | 1e-136 | |
| 356542713 | 502 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.651 | 0.710 | 1e-136 | |
| 357471937 | 509 | 2,3-bisphosphoglycerate-dependent phosph | 0.926 | 0.648 | 0.679 | 1e-134 |
| >gi|224132056|ref|XP_002328174.1| predicted protein [Populus trichocarpa] gi|222837689|gb|EEE76054.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 538 bits (1385), Expect = e-150, Method: Compositional matrix adjust.
Identities = 278/361 (77%), Positives = 307/361 (85%), Gaps = 9/361 (2%)
Query: 1 MLSFPVTPSL-LNHSH---LLHHRPY-FSFTVRSSSSSSAVQEVEESSKSTADAGELSSE 55
MLS PSL L H H L+HH + FTVRSSSSSS + VEE K++ + LSSE
Sbjct: 1 MLSVSPPPSLPLLHHHNRSLIHHGNHRLLFTVRSSSSSSIQEAVEE--KTSNEKNLLSSE 58
Query: 56 LYVSPPFPQIRAAKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDES 115
LY + PFP I+AAKRV+LVRHGQSTWN EGRIQGSSDFSVLTKKGEAQAETSRQML D+S
Sbjct: 59 LYSTTPFPSIKAAKRVILVRHGQSTWNEEGRIQGSSDFSVLTKKGEAQAETSRQMLIDDS 118
Query: 116 FDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQW 175
FDVCFSSPLIRSKRTAEIIWG+RK ++TD DLREIDLYSFQGLLKHEGK KFG A+RQW
Sbjct: 119 FDVCFSSPLIRSKRTAEIIWGSRKVNMITDSDLREIDLYSFQGLLKHEGKEKFGAAFRQW 178
Query: 176 QVNPANFSIDGHYPVRELWARARNCWTKILAHESKSVLVVAHNAVNQALVATAIGLGTGF 235
QV+ +NF+IDGH+PVRELW RARNCW KILAHES+SVLVVAHNAVNQALVATAIGLGT +
Sbjct: 179 QVDASNFNIDGHFPVRELWGRARNCWNKILAHESRSVLVVAHNAVNQALVATAIGLGTEY 238
Query: 236 FRILLQSNCGVSVLDFTPSVDG--GSPHICLNRLNQTPNSPVAAGSSGGRKASKRIILVC 293
FRILLQSNCGVSVLDF P VDG GSP+ICLNRLNQTPNSPVAAGSS GRK SKRIILV
Sbjct: 239 FRILLQSNCGVSVLDFAPRVDGGDGSPYICLNRLNQTPNSPVAAGSSAGRKTSKRIILVS 298
Query: 294 YGTTQGDSEASVAYSAEQPMNMLGIIQAQKTAELLLDLNVSSIVSSPKNACVQTAEAISR 353
+GTTQG +EA+ + S QPM+MLGIIQ+QKTAELLLDLNVS+IVSSPKNA V+ A ISR
Sbjct: 299 HGTTQGGTEATFSNSGNQPMSMLGIIQSQKTAELLLDLNVSTIVSSPKNASVEMATTISR 358
Query: 354 V 354
V
Sbjct: 359 V 359
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449456094|ref|XP_004145785.1| PREDICTED: uncharacterized protein LOC101205520 [Cucumis sativus] gi|449496250|ref|XP_004160084.1| PREDICTED: uncharacterized LOC101205520 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255585855|ref|XP_002533602.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223526503|gb|EEF28771.1| phosphoglycerate mutase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297734844|emb|CBI17078.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359479415|ref|XP_002270787.2| PREDICTED: uncharacterized protein LOC100255054 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147803507|emb|CAN68722.1| hypothetical protein VITISV_033681 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|353227769|emb|CCE25834.1| 2-carboxy-D-arabinitol 1-phosphate (CA1P) phosphatase [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|371782085|emb|CCE46056.1| 2-carboxy-D-arabinitol 1-phosphate (CA1P) phosphatase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|356542713|ref|XP_003539810.1| PREDICTED: uncharacterized protein LOC100794084 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357471937|ref|XP_003606253.1| 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Medicago truncatula] gi|355507308|gb|AES88450.1| 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| TAIR|locus:2162449 | 482 | AT5G22620 [Arabidopsis thalian | 0.814 | 0.601 | 0.756 | 6.2e-117 | |
| UNIPROTKB|P0A7A2 | 215 | ytjC "predicted phosphoglycera | 0.505 | 0.837 | 0.343 | 9.6e-16 | |
| TAIR|locus:2098690 | 230 | AT3G50520 [Arabidopsis thalian | 0.438 | 0.678 | 0.355 | 6.2e-15 | |
| TIGR_CMR|DET_1422 | 207 | DET_1422 "phosphoglycerate mut | 0.455 | 0.782 | 0.312 | 1.9e-13 | |
| TIGR_CMR|DET_0659 | 200 | DET_0659 "alpha-ribazole-5-pho | 0.502 | 0.895 | 0.296 | 1.2e-11 | |
| TIGR_CMR|DET_0693 | 200 | DET_0693 "alpha-ribazole-5-pho | 0.502 | 0.895 | 0.296 | 1.2e-11 | |
| TAIR|locus:2146678 | 238 | AT5G04120 [Arabidopsis thalian | 0.429 | 0.642 | 0.354 | 1e-10 | |
| TIGR_CMR|BA_2044 | 205 | BA_2044 "phosphoglycerate muta | 0.449 | 0.780 | 0.277 | 1.2e-10 | |
| TIGR_CMR|BA_4144 | 192 | BA_4144 "phosphoglycerate muta | 0.452 | 0.838 | 0.301 | 8.6e-09 | |
| TIGR_CMR|GSU_3007 | 217 | GSU_3007 "phosphoglycerate mut | 0.5 | 0.820 | 0.263 | 8.3e-08 |
| TAIR|locus:2162449 AT5G22620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1152 (410.6 bits), Expect = 6.2e-117, P = 6.2e-117
Identities = 221/292 (75%), Positives = 251/292 (85%)
Query: 65 IRAAKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPL 124
+ KRVVLVRHGQSTWN EGRIQGSSDFSVLTKKGE+QAE SRQML D+SFDVCF+SPL
Sbjct: 44 VETTKRVVLVRHGQSTWNEEGRIQGSSDFSVLTKKGESQAEISRQMLIDDSFDVCFTSPL 103
Query: 125 IRSKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSI 184
RSK+TAEIIWG+R+ E++ DYDLREIDLYSFQGLLK EGK KFG A++QWQ +PANF I
Sbjct: 104 KRSKKTAEIIWGSRESEMIFDYDLREIDLYSFQGLLKKEGKEKFGEAFKQWQEDPANFII 163
Query: 185 DGHYPVRELWARARNCWTKILAHESKSVLVVAHNAVNQALVATAIGLGTGFFRILLQSNC 244
DGHYPVRELW+RAR+CW ILAHESKSVLVVAHNAVNQAL+ATAIGLGT +FR LLQSNC
Sbjct: 164 DGHYPVRELWSRARSCWPGILAHESKSVLVVAHNAVNQALLATAIGLGTEYFRSLLQSNC 223
Query: 245 GVSVLDFTPSVDGGSPHICLNRLNQTPNSPVAAGSSGGRKASKRIILVCYGTTQGDSEAS 304
GVSVLDF P DGGSPH+CLNRLNQTPNSP+A GSSGGRKASK+IILVC+G + A
Sbjct: 224 GVSVLDFIPRADGGSPHVCLNRLNQTPNSPLAGGSSGGRKASKQIILVCHGQGNNEDSAV 283
Query: 305 VAYSA--EQPMNMLGIIQAQKTAELLLDLNVSSIVSSPKNACVQTAEAISRV 354
+ +A +Q MNMLG+I +QKTAELLLDL VSSIV SPK A ++++ ISRV
Sbjct: 284 INQAANNDQAMNMLGVIHSQKTAELLLDLRVSSIVCSPKTASIESSGVISRV 335
|
|
| UNIPROTKB|P0A7A2 ytjC "predicted phosphoglycerate mutase 2" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098690 AT3G50520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1422 DET_1422 "phosphoglycerate mutase family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0659 DET_0659 "alpha-ribazole-5-phosphate phosphatase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0693 DET_0693 "alpha-ribazole-5-phosphate phosphatase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146678 AT5G04120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_2044 BA_2044 "phosphoglycerate mutase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4144 BA_4144 "phosphoglycerate mutase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3007 GSU_3007 "phosphoglycerate mutase family, putative" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_660026 | hypothetical protein (518 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.113440001 | • | 0.441 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| COG0406 | 208 | COG0406, phoE, Broad specificity phosphatase PhoE | 3e-45 | |
| pfam00300 | 154 | pfam00300, His_Phos_1, Histidine phosphatase super | 1e-43 | |
| smart00855 | 158 | smart00855, PGAM, Phosphoglycerate mutase family | 1e-33 | |
| cd07067 | 153 | cd07067, HP_PGM_like, Histidine phosphatase domain | 2e-32 | |
| TIGR03162 | 177 | TIGR03162, ribazole_cobC, alpha-ribazole phosphata | 3e-26 | |
| cd07040 | 153 | cd07040, HP, Histidine phosphatase domain found in | 3e-23 | |
| PRK03482 | 215 | PRK03482, PRK03482, phosphoglycerate mutase; Provi | 2e-20 | |
| PRK07238 | 372 | PRK07238, PRK07238, bifunctional RNase H/acid phos | 3e-15 | |
| TIGR01258 | 245 | TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep | 3e-14 | |
| TIGR03848 | 204 | TIGR03848, MSMEG_4193, probable phosphomutase, MSM | 3e-14 | |
| COG0588 | 230 | COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd | 1e-13 | |
| PRK01295 | 206 | PRK01295, PRK01295, phosphoglyceromutase; Provisio | 7e-13 | |
| PRK14115 | 247 | PRK14115, gpmA, phosphoglyceromutase; Provisional | 4e-12 | |
| PRK15004 | 199 | PRK15004, PRK15004, alpha-ribazole phosphatase; Pr | 6e-12 | |
| PRK13463 | 203 | PRK13463, PRK13463, phosphatase PhoE; Provisional | 1e-10 | |
| PRK13462 | 203 | PRK13462, PRK13462, acid phosphatase; Provisional | 6e-10 | |
| PRK01112 | 228 | PRK01112, PRK01112, phosphoglyceromutase; Provisio | 6e-09 | |
| PTZ00123 | 236 | PTZ00123, PTZ00123, phosphoglycerate mutase like-p | 8e-09 | |
| PRK14119 | 228 | PRK14119, gpmA, phosphoglyceromutase; Provisional | 1e-08 | |
| PRK14120 | 249 | PRK14120, gpmA, phosphoglyceromutase; Provisional | 2e-08 | |
| PRK14118 | 227 | PRK14118, gpmA, phosphoglyceromutase; Provisional | 1e-06 | |
| COG0406 | 208 | COG0406, phoE, Broad specificity phosphatase PhoE | 8e-06 | |
| pfam00300 | 154 | pfam00300, His_Phos_1, Histidine phosphatase super | 2e-05 | |
| PRK14116 | 228 | PRK14116, gpmA, phosphoglyceromutase; Provisional | 4e-05 | |
| PTZ00122 | 299 | PTZ00122, PTZ00122, phosphoglycerate mutase; Provi | 2e-04 | |
| cd07067 | 153 | cd07067, HP_PGM_like, Histidine phosphatase domain | 4e-04 | |
| PRK14117 | 230 | PRK14117, gpmA, phosphoglyceromutase; Provisional | 7e-04 | |
| COG2062 | 163 | COG2062, SixA, Phosphohistidine phosphatase SixA [ | 0.001 | |
| TIGR03848 | 204 | TIGR03848, MSMEG_4193, probable phosphomutase, MSM | 0.003 |
| >gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
Score = 153 bits (389), Expect = 3e-45
Identities = 69/209 (33%), Positives = 100/209 (47%), Gaps = 8/209 (3%)
Query: 69 KRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQML--FDESFDVCFSSPLIR 126
R+ LVRHG++ WN EGR+QG +D S LT++G AQAE + L D FD +SSPL R
Sbjct: 3 MRLYLVRHGETEWNVEGRLQGWTD-SPLTEEGRAQAEALAERLAARDIGFDAIYSSPLKR 61
Query: 127 SKRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDG 186
+++TAE + + D LREID ++GL E + W +P G
Sbjct: 62 AQQTAEPLAEELGLPLEVDDRLREIDFGDWEGLTIDELAEEPPEELAAWLADPYLAPPPG 121
Query: 187 HYPVRELWARARNCWTKILA-HESKSVLVVAHNAVNQALVATAIGLGTGFFRILLQSNCG 245
+ ++ R ++L +VLVV+H V +AL+A +GL L N
Sbjct: 122 GESLADVSKRVVAALAELLRSPPGNNVLVVSHGGVIRALLAYLLGLDLEELWRLRLDNAS 181
Query: 246 VSVLDFTPSVDGGSPHICLNRLNQTPNSP 274
V+VL+F D G L L+
Sbjct: 182 VTVLEF----DDGRFIRTLGDLSYLEAGR 206
|
Length = 208 |
| >gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) | Back alignment and domain information |
|---|
| >gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139587 PRK13462, PRK13462, acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) | Back alignment and domain information |
|---|
| >gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240279 PTZ00122, PTZ00122, phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224973 COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| PRK13463 | 203 | phosphatase PhoE; Provisional | 100.0 | |
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 100.0 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 100.0 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 100.0 | |
| PRK14116 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 100.0 | |
| PRK14117 | 230 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK01112 | 228 | phosphoglyceromutase; Provisional | 100.0 | |
| PRK14118 | 227 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK01295 | 206 | phosphoglyceromutase; Provisional | 100.0 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 100.0 | |
| COG0406 | 208 | phoE Broad specificity phosphatase PhoE and relate | 100.0 | |
| PRK14120 | 249 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 100.0 | |
| TIGR01258 | 245 | pgm_1 phosphoglycerate mutase, BPG-dependent, fami | 100.0 | |
| PRK14115 | 247 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| KOG0235 | 214 | consensus Phosphoglycerate mutase [Carbohydrate tr | 100.0 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 100.0 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 100.0 | |
| PTZ00123 | 236 | phosphoglycerate mutase like-protein; Provisional | 100.0 | |
| COG0588 | 230 | GpmA Phosphoglycerate mutase 1 [Carbohydrate trans | 99.97 | |
| smart00855 | 155 | PGAM Phosphoglycerate mutase family. Phosphoglycer | 99.97 | |
| PTZ00122 | 299 | phosphoglycerate mutase; Provisional | 99.97 | |
| cd07067 | 153 | HP_PGM_like Histidine phosphatase domain found in | 99.94 | |
| cd07040 | 153 | HP Histidine phosphatase domain found in a functio | 99.9 | |
| KOG4754 | 248 | consensus Predicted phosphoglycerate mutase [Carbo | 99.86 | |
| TIGR00249 | 152 | sixA phosphohistidine phosphatase SixA. | 99.85 | |
| KOG4609 | 284 | consensus Predicted phosphoglycerate mutase [Gener | 99.85 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 99.84 | |
| PRK10848 | 159 | phosphohistidine phosphatase; Provisional | 99.82 | |
| PRK06193 | 206 | hypothetical protein; Provisional | 99.8 | |
| KOG3734 | 272 | consensus Predicted phosphoglycerate mutase [Carbo | 99.79 | |
| PRK14116 | 228 | gpmA phosphoglyceromutase; Provisional | 99.78 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 99.77 | |
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 99.77 | |
| PRK13463 | 203 | phosphatase PhoE; Provisional | 99.76 | |
| COG2062 | 163 | SixA Phosphohistidine phosphatase SixA [Signal tra | 99.75 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 99.75 | |
| PRK14117 | 230 | gpmA phosphoglyceromutase; Provisional | 99.75 | |
| PRK01112 | 228 | phosphoglyceromutase; Provisional | 99.75 | |
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 99.74 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 99.73 | |
| PRK14118 | 227 | gpmA phosphoglyceromutase; Provisional | 99.73 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.73 | |
| COG0406 | 208 | phoE Broad specificity phosphatase PhoE and relate | 99.72 | |
| PRK14120 | 249 | gpmA phosphoglyceromutase; Provisional | 99.71 | |
| PRK01295 | 206 | phosphoglyceromutase; Provisional | 99.71 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 99.71 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 99.71 | |
| PRK14115 | 247 | gpmA phosphoglyceromutase; Provisional | 99.7 | |
| TIGR01258 | 245 | pgm_1 phosphoglycerate mutase, BPG-dependent, fami | 99.7 | |
| KOG0235 | 214 | consensus Phosphoglycerate mutase [Carbohydrate tr | 99.67 | |
| smart00855 | 155 | PGAM Phosphoglycerate mutase family. Phosphoglycer | 99.66 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 99.64 | |
| TIGR00249 | 152 | sixA phosphohistidine phosphatase SixA. | 99.62 | |
| cd07067 | 153 | HP_PGM_like Histidine phosphatase domain found in | 99.61 | |
| COG2062 | 163 | SixA Phosphohistidine phosphatase SixA [Signal tra | 99.61 | |
| PRK10848 | 159 | phosphohistidine phosphatase; Provisional | 99.6 | |
| COG0588 | 230 | GpmA Phosphoglycerate mutase 1 [Carbohydrate trans | 99.56 | |
| cd07040 | 153 | HP Histidine phosphatase domain found in a functio | 99.55 | |
| PTZ00122 | 299 | phosphoglycerate mutase; Provisional | 99.54 | |
| PRK06193 | 206 | hypothetical protein; Provisional | 99.54 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.46 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 99.44 | |
| KOG4754 | 248 | consensus Predicted phosphoglycerate mutase [Carbo | 99.09 | |
| KOG4609 | 284 | consensus Predicted phosphoglycerate mutase [Gener | 98.88 | |
| KOG3734 | 272 | consensus Predicted phosphoglycerate mutase [Carbo | 98.35 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 98.27 | |
| cd07061 | 242 | HP_HAP_like Histidine phosphatase domain found in | 98.24 | |
| cd07061 | 242 | HP_HAP_like Histidine phosphatase domain found in | 97.39 | |
| PF00328 | 347 | His_Phos_2: Histidine phosphatase superfamily (bra | 96.56 | |
| PTZ00123 | 236 | phosphoglycerate mutase like-protein; Provisional | 96.15 | |
| KOG3720 | 411 | consensus Lysosomal & prostatic acid phosphatases | 96.1 | |
| PRK10172 | 436 | phosphoanhydride phosphorylase; Provisional | 95.46 | |
| PRK10173 | 413 | glucose-1-phosphatase/inositol phosphatase; Provis | 95.22 | |
| PF00328 | 347 | His_Phos_2: Histidine phosphatase superfamily (bra | 94.8 | |
| KOG3720 | 411 | consensus Lysosomal & prostatic acid phosphatases | 91.46 | |
| PRK10172 | 436 | phosphoanhydride phosphorylase; Provisional | 90.47 | |
| PRK10173 | 413 | glucose-1-phosphatase/inositol phosphatase; Provis | 89.93 | |
| KOG1382 | 467 | consensus Multiple inositol polyphosphate phosphat | 89.1 | |
| KOG3672 | 487 | consensus Histidine acid phosphatase [General func | 88.05 | |
| KOG1057 | 1018 | consensus Arp2/3 complex-interacting protein VIP1/ | 86.52 | |
| KOG1057 | 1018 | consensus Arp2/3 complex-interacting protein VIP1/ | 82.77 |
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-42 Score=307.63 Aligned_cols=199 Identities=24% Similarity=0.347 Sum_probs=182.6
Q ss_pred ceEEEEEeCCCCCccccCCccCCCCCCCCCHHHHHHHHHHHHHhhcCCCCEEEECCcHHHHHHHHHHHhcCCCceeeccc
Q 018441 68 AKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYD 147 (356)
Q Consensus 68 ~~~i~LiRHGes~~n~~~~~~g~~d~~pLT~~G~~QA~~l~~~L~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~~i~~~~~ 147 (356)
+++||||||||+.+|..++++|+.| +|||+.|++||+.+++.|.+.+++.|||||+.||+|||++|++..++++.++++
T Consensus 2 ~~~i~lvRHG~t~~n~~~~~~G~~d-~~Lt~~G~~Qa~~~~~~l~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~~~~~~~~ 80 (203)
T PRK13463 2 KTTVYVTRHGETEWNVAKRMQGRKN-SALTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 (203)
T ss_pred ceEEEEEeCCCCccchhCcccCCCC-CCcCHHHHHHHHHHHHHhcCCCCCEEEECCcHHHHHHHHHHHhcCCCCceECcC
Confidence 5789999999999999999999998 589999999999999999999999999999999999999999888899999999
Q ss_pred cccccccccCCCchhhhhhhccHHHHHhhcCCCCCCCCCCCCHHHHHHHHHHHHHHHHh-cCCCeEEEEcChHHHHHHHH
Q 018441 148 LREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILA-HESKSVLVVAHNAVNQALVA 226 (356)
Q Consensus 148 L~E~~~g~~eg~~~~e~~~~~~~~~~~w~~~~~~~~~~~~Es~~~~~~R~~~~~~~l~~-~~~~~vlvVsHg~~i~~l~~ 226 (356)
|+|+++|.|+|++..++.+.||..+..|+.++..+.+|++||+.++..|+..+++.+.. ..+++|||||||++|+++++
T Consensus 81 l~E~~~G~~eG~~~~e~~~~~p~~~~~~~~~~~~~~~~~gEs~~~~~~R~~~~l~~i~~~~~~~~vlvVsHg~~ir~~~~ 160 (203)
T PRK13463 81 FYEINMGIWEGQTIDDIERQYPDDIQLFWNEPHLFQSTSGENFEAVHKRVIEGMQLLLEKHKGESILIVSHAAAAKLLVG 160 (203)
T ss_pred ceeCCCCccCCCcHHHHhhhCHHHHHHHHhChhccCCCCCeEHHHHHHHHHHHHHHHHHhCCCCEEEEEeChHHHHHHHH
Confidence 99999999999999999999999999999888888889999999999999999999986 56789999999999999999
Q ss_pred HHhCCCccchhcc-ccCCccEEEEEEecCCCCCCceEEeccccCCCCC
Q 018441 227 TAIGLGTGFFRIL-LQSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNS 273 (356)
Q Consensus 227 ~l~g~~~~~~~~~-~~~n~si~~l~~~~~~~~~~~~~~~~~~N~~~~~ 273 (356)
+++|.+.+.+..+ .+.||++++++++++. +.+..+|.++|+
T Consensus 161 ~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~------~~~~~~n~~~~l 202 (203)
T PRK13463 161 HFAGIEIENVWDDPFMHSASLSIIEFEDGK------GEVKQFADISHF 202 (203)
T ss_pred HHhCCCHHHHhhccCccCceEEEEEEeCCc------EEEEEecccccc
Confidence 9999998877665 4689999999996532 356788988875
|
|
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >PRK14116 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14117 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01112 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14118 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01295 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14120 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >PRK14115 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >PTZ00123 phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00855 PGAM Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >PTZ00122 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00249 sixA phosphohistidine phosphatase SixA | Back alignment and domain information |
|---|
| >KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10848 phosphohistidine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06193 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14116 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >PRK14117 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01112 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14118 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14120 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01295 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >PRK14115 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00855 PGAM Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >TIGR00249 sixA phosphohistidine phosphatase SixA | Back alignment and domain information |
|---|
| >cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10848 phosphohistidine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PTZ00122 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >PRK06193 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >PTZ00123 phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >KOG3720 consensus Lysosomal & prostatic acid phosphatases [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10172 phosphoanhydride phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >KOG3720 consensus Lysosomal & prostatic acid phosphatases [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10172 phosphoanhydride phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1382 consensus Multiple inositol polyphosphate phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3672 consensus Histidine acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 356 | ||||
| 1ebb_A | 202 | Bacillus Stearothermophilus Yhfr Length = 202 | 2e-09 | ||
| 1h2e_A | 207 | Bacillus Stearothermophilus Phoe (Previously Known | 2e-09 | ||
| 4emb_A | 274 | Crystal Structure Of A Phosphoglycerate Mutase Gpma | 6e-09 | ||
| 3d8h_A | 267 | Crystal Structure Of Phosphoglycerate Mutase From C | 6e-09 | ||
| 1e59_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase C | 2e-08 | ||
| 3ezn_A | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 8e-08 | ||
| 3lnt_A | 250 | Crystal Structure Of Phosphoglyceromutase From Burk | 9e-08 | ||
| 1e58_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase L | 3e-07 | ||
| 2eoa_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 3e-07 | ||
| 2p9z_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 4e-07 | ||
| 1xq9_A | 258 | Structure Of Phosphoglycerate Mutase From Plasmodiu | 5e-07 | ||
| 3kkk_A | 258 | Y92c Catalytic Residue Mutant Of Phosphoglycerate M | 5e-07 | ||
| 2owe_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-07 | ||
| 2p6o_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-07 | ||
| 2p9y_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-07 | ||
| 2p30_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-07 | ||
| 2p2z_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-07 | ||
| 2enw_A | 177 | Mutant Y92h Structure Of Tthb049 From Thermus Therm | 6e-07 | ||
| 2enu_A | 177 | Mutant L121m Structure Of Tthb049 From Thermus Ther | 6e-07 | ||
| 2p9f_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 2p79_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 2p78_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 1v37_A | 177 | Crystal Structure Of Phosphoglycerate Mutase From T | 7e-07 | ||
| 2owd_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 2p77_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 2p6m_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-07 | ||
| 2ekb_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 7e-07 | ||
| 3fdz_B | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 1e-06 | ||
| 2p75_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-06 | ||
| 2pa0_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-06 | ||
| 2p2y_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-06 | ||
| 2ekz_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 1e-06 | ||
| 1yfk_A | 262 | Crystal Structure Of Human B Type Phosphoglycerate | 2e-06 | ||
| 3f3k_A | 265 | The Structure Of Uncharacterized Protein Ykr043c Fr | 2e-06 | ||
| 3lg2_A | 292 | A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex | 2e-06 | ||
| 1rii_A | 265 | Crystal Structure Of Phosphoglycerate Mutase From M | 3e-06 | ||
| 3ll4_A | 292 | Structure Of The H13a Mutant Of Ykr043c In Complex | 5e-06 | ||
| 3e9c_A | 265 | Structure Of A Tryptic Core Fragment Of Tigar From | 6e-06 | ||
| 3hjg_A | 213 | Crystal Structure Of Putative Alpha-Ribazole-5'-Pho | 2e-05 | ||
| 1fzt_A | 211 | Solution Structure And Dynamics Of An Open B-Sheet, | 2e-05 | ||
| 3oi7_A | 292 | Structure Of The Structure Of The H13a Mutant Of Yk | 4e-05 | ||
| 4eo9_A | 268 | Crystal Structure Of A Phosphoglycerate Mutase Gpm1 | 6e-05 | ||
| 2a6p_A | 208 | Structure Solution To 2.2 Angstrom And Functional C | 7e-05 | ||
| 3e9e_A | 265 | Structure Of Full-Length H11a Mutant Form Of Tigar | 1e-04 | ||
| 1qhf_A | 240 | Yeast Phosphoglycerate Mutase-3pg Complex Structure | 1e-04 | ||
| 4pgm_A | 246 | Saccharomyces Cerevisiae Phosphoglycerate Mutase Le | 1e-04 | ||
| 3pgm_A | 244 | The Structure Of Yeast Phosphoglycerate Mutase At 0 | 7e-04 |
| >pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 | Back alignment and structure |
|
| >pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 | Back alignment and structure |
| >pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 | Back alignment and structure |
| >pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 | Back alignment and structure |
| >pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 | Back alignment and structure |
| >pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 | Back alignment and structure |
| >pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 | Back alignment and structure |
| >pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 | Back alignment and structure |
| >pdb|2EOA|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (W85h) Length = 177 | Back alignment and structure |
| >pdb|2P9Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 | Back alignment and structure |
| >pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 | Back alignment and structure |
| >pdb|2OWE|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P6O|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P9Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P30|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P2Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2ENW|A Chain A, Mutant Y92h Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2ENU|A Chain A, Mutant L121m Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P9F|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P79|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P78|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|1V37|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2OWD|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P77|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P6M|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2EKB|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (L19m) Length = 177 | Back alignment and structure |
| >pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 | Back alignment and structure |
| >pdb|2P75|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2PA0|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P2Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2EKZ|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (l52m) Length = 177 | Back alignment and structure |
| >pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 | Back alignment and structure |
| >pdb|3F3K|A Chain A, The Structure Of Uncharacterized Protein Ykr043c From Saccharomyces Cerevisiae. Length = 265 | Back alignment and structure |
| >pdb|3LG2|A Chain A, A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex Following Ligand Soaking Length = 292 | Back alignment and structure |
| >pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 | Back alignment and structure |
| >pdb|3LL4|A Chain A, Structure Of The H13a Mutant Of Ykr043c In Complex With Fructose-1,6- Bisphosphate Length = 292 | Back alignment and structure |
| >pdb|3E9C|A Chain A, Structure Of A Tryptic Core Fragment Of Tigar From Danio Rerio Length = 265 | Back alignment and structure |
| >pdb|3HJG|A Chain A, Crystal Structure Of Putative Alpha-Ribazole-5'-Phosphate Phosphatase Cobc From Vibrio Parahaemolyticus Length = 213 | Back alignment and structure |
| >pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 | Back alignment and structure |
| >pdb|3OI7|A Chain A, Structure Of The Structure Of The H13a Mutant Of Ykr043c In Complex With Sedoheptulose-1,7-Bisphosphate Length = 292 | Back alignment and structure |
| >pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 | Back alignment and structure |
| >pdb|2A6P|A Chain A, Structure Solution To 2.2 Angstrom And Functional Characterisation Of The Open Reading Frame Rv3214 From Mycobacterium Tuberculosis Length = 208 | Back alignment and structure |
| >pdb|3E9E|A Chain A, Structure Of Full-Length H11a Mutant Form Of Tigar From Danio Rerio Length = 265 | Back alignment and structure |
| >pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 | Back alignment and structure |
| >pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 | Back alignment and structure |
| >pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 1e-57 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 1e-04 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 2e-48 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 3e-48 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 1e-44 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 1e-07 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 2e-43 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 5e-04 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 7e-41 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 5e-39 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 9e-35 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 3e-31 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 1e-29 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 3e-29 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 3e-29 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 3e-05 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 7e-29 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 3e-06 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 1e-20 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 2e-20 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 3e-20 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 4e-20 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 5e-20 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 6e-05 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 8e-20 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 1e-04 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 8e-20 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-19 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 1e-19 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 1e-19 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 3e-19 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 3e-19 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 4e-19 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 4e-17 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 4e-09 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 4e-08 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 5e-08 |
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 | Back alignment and structure |
|---|
Score = 185 bits (471), Expect = 1e-57
Identities = 54/203 (26%), Positives = 86/203 (42%), Gaps = 9/203 (4%)
Query: 70 RVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKR 129
+ L RHG++ WN E R+QG D S LT+KG A + L ++S R+
Sbjct: 3 TLYLTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALE 61
Query: 130 TAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYP 189
TAEI+ G R I D LREI L ++G E + A+ + P ++
Sbjct: 62 TAEIVRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGER 121
Query: 190 VRELWARARNCWTKILA-HESKSVLVVAHNAVNQALVATAIGLG-TGFFRILLQSNCGVS 247
++ RA I+ HE ++VL+V H V + L+A + V+
Sbjct: 122 FCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGTSVT 181
Query: 248 VLDFTPSVDGGSPHICLNRLNQT 270
+++ DGG+ H +
Sbjct: 182 IIEV----DGGTFH--VAVEGDV 198
|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Length = 172 | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Length = 173 | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Length = 161 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 100.0 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 100.0 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 100.0 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 100.0 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 100.0 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 100.0 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 100.0 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 100.0 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 100.0 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 100.0 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 100.0 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 100.0 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 100.0 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 100.0 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 100.0 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 100.0 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 100.0 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 100.0 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 100.0 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 100.0 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 100.0 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 100.0 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 100.0 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 99.96 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 99.94 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.91 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 99.87 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 99.76 | |
| 4hbz_A | 186 | Putative phosphohistidine phosphatase, SIXA; struc | 99.76 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 99.75 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 99.75 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 99.74 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 99.74 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 99.74 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.74 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.74 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 99.74 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 99.74 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.73 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 99.72 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 99.72 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 99.72 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.71 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 99.71 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 99.7 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 99.69 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 99.69 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 99.68 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 99.68 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 99.67 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 99.65 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 99.64 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 99.64 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 99.64 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 99.63 | |
| 4hbz_A | 186 | Putative phosphohistidine phosphatase, SIXA; struc | 99.56 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.53 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 99.48 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 99.46 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.45 | |
| 1nd6_A | 354 | Prostatic acid phosphatase; PAP, prostate, phospha | 95.91 | |
| 1dkq_A | 410 | Phytase; histidine acid phosphatase fold, hydrolas | 95.69 | |
| 3it3_A | 342 | Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A | 95.57 | |
| 3ntl_A | 398 | Acid glucose-1-phosphate phosphatase; histidine ac | 95.18 | |
| 3k4q_A | 444 | 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex | 94.96 | |
| 1qwo_A | 442 | Phytase; alpha barrel, beta sandwich, orthogonal b | 94.9 | |
| 2wnh_A | 418 | 3-phytase; histidine acid phosphatase, hydrolase; | 94.88 | |
| 1nd6_A | 354 | Prostatic acid phosphatase; PAP, prostate, phospha | 93.61 | |
| 3it3_A | 342 | Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A | 92.85 | |
| 1dkq_A | 410 | Phytase; histidine acid phosphatase fold, hydrolas | 91.86 | |
| 3ntl_A | 398 | Acid glucose-1-phosphate phosphatase; histidine ac | 91.46 | |
| 2gfi_A | 458 | Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces | 91.25 | |
| 2wnh_A | 418 | 3-phytase; histidine acid phosphatase, hydrolase; | 91.21 | |
| 3k4q_A | 444 | 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex | 86.76 |
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-42 Score=308.40 Aligned_cols=200 Identities=25% Similarity=0.307 Sum_probs=186.2
Q ss_pred eEEEEEeCCCCCccccCCccCCCCCCCCCHHHHHHHHHHHHHhhcCCCCEEEECCcHHHHHHHHHHHhcCCCceeecccc
Q 018441 69 KRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDL 148 (356)
Q Consensus 69 ~~i~LiRHGes~~n~~~~~~g~~d~~pLT~~G~~QA~~l~~~L~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~~i~~~~~L 148 (356)
|+||||||||+.+|..++++|+.| +|||+.|++||+.++++|...++|.|||||+.||+|||+++++.+++++.+++.|
T Consensus 2 m~l~lvRHGet~~n~~~~~~g~~D-~pLt~~G~~qA~~~~~~l~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~~~~~~~~L 80 (207)
T 1h2e_A 2 TTLYLTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPIYQDERL 80 (207)
T ss_dssp EEEEEEECCCBHHHHTTBCCTTSC-CCBCHHHHHHHHHHHHHTTTSCCSEEEECSSHHHHHHHHHHHTTCSCCEEECGGG
T ss_pred CEEEEEeCcCCcccccccCCCCCC-CCCCHHHHHHHHHHHHHHcCCCCCEEEECccHHHHHHHHHHHhcCCCCeEECccc
Confidence 489999999999999999999988 5799999999999999999999999999999999999999999988999999999
Q ss_pred ccccccccCCCchhhhhhhccHHHHHhhcCCCCCCCCCCCCHHHHHHHHHHHHHHHHh-cCCCeEEEEcChHHHHHHHHH
Q 018441 149 REIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILA-HESKSVLVVAHNAVNQALVAT 227 (356)
Q Consensus 149 ~E~~~g~~eg~~~~e~~~~~~~~~~~w~~~~~~~~~~~~Es~~~~~~R~~~~~~~l~~-~~~~~vlvVsHg~~i~~l~~~ 227 (356)
+|++||.|+|++..++.+.+|..+..|..++..+.+|++||+.++.+|+..+++++.+ .++++|+|||||++|+++++.
T Consensus 81 ~E~~~G~~eg~~~~e~~~~~p~~~~~~~~~~~~~~~p~gEs~~~~~~R~~~~l~~l~~~~~~~~vlvVsHg~~i~~l~~~ 160 (207)
T 1h2e_A 81 REIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAA 160 (207)
T ss_dssp SCCCCGGGTTCBHHHHHHHCHHHHHHHHHCGGGCCCSSSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEECHHHHHHHHHH
T ss_pred ccCCceecCCCCHHHHHHHCHHHHHHHhhCccccCCCCCccHHHHHHHHHHHHHHHHHhCCCCeEEEEcCHHHHHHHHHH
Confidence 9999999999999999999999899999888778889999999999999999999987 567899999999999999999
Q ss_pred HhCCCccchhccc-cCCccEEEEEEecCCCCCCceEEeccccCCCCCcc
Q 018441 228 AIGLGTGFFRILL-QSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNSPV 275 (356)
Q Consensus 228 l~g~~~~~~~~~~-~~n~si~~l~~~~~~~~~~~~~~~~~~N~~~~~p~ 275 (356)
++|.+...+..+. ++||++++|+++++ .|.+..+|.++|++-
T Consensus 161 l~~~~~~~~~~~~~~~n~~i~~l~~~~~------~~~l~~~n~~~hL~~ 203 (207)
T 1h2e_A 161 FKDTPLDHLWSPPYMYGTSVTIIEVDGG------TFHVAVEGDVSHIEE 203 (207)
T ss_dssp HTTCCGGGTTCSCCCCTTCEEEEEEETT------EEEEEEEEECTTCSS
T ss_pred HhCCCHHHhhhccCCCCCEEEEEEEECC------EEEEEEEcCchhhhh
Confidence 9999988877787 99999999999763 268889999999764
|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A | Back alignment and structure |
|---|
| >1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A | Back alignment and structure |
|---|
| >3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* | Back alignment and structure |
|---|
| >3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* | Back alignment and structure |
|---|
| >3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A | Back alignment and structure |
|---|
| >1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* | Back alignment and structure |
|---|
| >2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A | Back alignment and structure |
|---|
| >1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A | Back alignment and structure |
|---|
| >3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* | Back alignment and structure |
|---|
| >1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A | Back alignment and structure |
|---|
| >3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* | Back alignment and structure |
|---|
| >2gfi_A Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces castellii} | Back alignment and structure |
|---|
| >2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A | Back alignment and structure |
|---|
| >3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 356 | ||||
| d1h2ea_ | 207 | c.60.1.1 (A:) Broad specificity phosphatase PhoE ( | 1e-30 | |
| d1fzta_ | 211 | c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea | 6e-28 | |
| d1e58a_ | 247 | c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia | 1e-26 | |
| d1qhfa_ | 240 | c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea | 1e-24 | |
| d1xq9a_ | 241 | c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium | 7e-24 | |
| d1bifa2 | 219 | c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc | 8e-21 | |
| d2hhja1 | 248 | c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human | 1e-20 | |
| d1riia_ | 243 | c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri | 1e-18 | |
| d1v37a_ | 171 | c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat | 3e-18 |
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Broad specificity phosphatase PhoE (YhfR) species: Bacillus stearothermophilus [TaxId: 1422]
Score = 113 bits (283), Expect = 1e-30
Identities = 54/206 (26%), Positives = 86/206 (41%), Gaps = 9/206 (4%)
Query: 68 AKRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRS 127
A + L RHG++ WN E R+QG D S LT+KG A + L ++S R+
Sbjct: 1 ATTLYLTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRA 59
Query: 128 KRTAEIIWGNRKEEILTDYDLREIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGH 187
TAEI+ G R I D LREI L ++G E + A+ + P ++
Sbjct: 60 LETAEIVRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRG 119
Query: 188 YPVRELWARARNCWTK-ILAHESKSVLVVAHNAVNQALVATAIGLG-TGFFRILLQSNCG 245
++ RA + HE ++VL+V H V + L+A +
Sbjct: 120 ERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGTS 179
Query: 246 VSVLDFTPSVDGGSPHICLNRLNQTP 271
V++++ DGG+ H +
Sbjct: 180 VTIIEV----DGGTFH--VAVEGDVS 199
|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 | Back information, alignment and structure |
|---|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 100.0 | |
| d1e58a_ | 247 | Phosphoglycerate mutase {Escherichia coli [TaxId: | 100.0 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 100.0 | |
| d1riia_ | 243 | Phosphoglycerate mutase {Mycobacterium tuberculosi | 100.0 | |
| d1bifa2 | 219 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 100.0 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 100.0 | |
| d1xq9a_ | 241 | Phosphoglycerate mutase {Plasmodium falciparum [Ta | 100.0 | |
| d1qhfa_ | 240 | Phosphoglycerate mutase {Baker's yeast (Saccharomy | 100.0 | |
| d1v37a_ | 171 | Alpha-ribazole-5'-phosphate phosphatase {Thermus t | 100.0 | |
| d1e58a_ | 247 | Phosphoglycerate mutase {Escherichia coli [TaxId: | 99.78 | |
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 99.76 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 99.72 | |
| d1riia_ | 243 | Phosphoglycerate mutase {Mycobacterium tuberculosi | 99.71 | |
| d1qhfa_ | 240 | Phosphoglycerate mutase {Baker's yeast (Saccharomy | 99.7 | |
| d1xq9a_ | 241 | Phosphoglycerate mutase {Plasmodium falciparum [Ta | 99.69 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 99.69 | |
| d1bifa2 | 219 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.65 | |
| d1v37a_ | 171 | Alpha-ribazole-5'-phosphate phosphatase {Thermus t | 99.64 | |
| d1qwoa_ | 435 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.93 | |
| d1nd6a_ | 342 | Prostatic acid phosphatase {Human (Homo sapiens) [ | 96.86 | |
| d1dkla_ | 409 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.55 | |
| d1ihpa_ | 438 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.5 | |
| d1nt4a_ | 391 | Glucose-1-phosphatase {Escherichia coli [TaxId: 56 | 96.49 | |
| d1qfxa_ | 447 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.34 | |
| d1nd6a_ | 342 | Prostatic acid phosphatase {Human (Homo sapiens) [ | 95.13 | |
| d1ihpa_ | 438 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 94.97 | |
| d1qwoa_ | 435 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 94.91 | |
| d1dkla_ | 409 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 94.63 | |
| d1nt4a_ | 391 | Glucose-1-phosphatase {Escherichia coli [TaxId: 56 | 93.99 | |
| d1qfxa_ | 447 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 92.36 |
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Broad specificity phosphatase PhoE (YhfR) species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00 E-value=1.4e-43 Score=312.74 Aligned_cols=199 Identities=25% Similarity=0.315 Sum_probs=186.2
Q ss_pred eEEEEEeCCCCCccccCCccCCCCCCCCCHHHHHHHHHHHHHhhcCCCCEEEECCcHHHHHHHHHHHhcCCCceeecccc
Q 018441 69 KRVVLVRHGQSTWNAEGRIQGSSDFSVLTKKGEAQAETSRQMLFDESFDVCFSSPLIRSKRTAEIIWGNRKEEILTDYDL 148 (356)
Q Consensus 69 ~~i~LiRHGes~~n~~~~~~g~~d~~pLT~~G~~QA~~l~~~L~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~~i~~~~~L 148 (356)
++||||||||+.+|..++++|+.| +|||+.|++||++++++|++..++.|||||+.||+|||+.+++..++++.+++.|
T Consensus 2 tti~lvRHGet~~n~~~~~~G~~D-~~Lt~~G~~QA~~~~~~l~~~~~~~i~sSpl~Ra~qTa~~i~~~~~~~~~~~~~L 80 (207)
T d1h2ea_ 2 TTLYLTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPIYQDERL 80 (207)
T ss_dssp EEEEEEECCCBHHHHTTBCCTTSC-CCBCHHHHHHHHHHHHHTTTSCCSEEEECSSHHHHHHHHHHHTTCSCCEEECGGG
T ss_pred cEEEEEeCCCCCccccCcccCCCC-CCCCHHHHHHHHHHHhhhhccccceeecCccHHHHHHHhhhcccccccccccccc
Confidence 689999999999999999999998 5799999999999999999999999999999999999999999999999999999
Q ss_pred ccccccccCCCchhhhhhhccHHHHHhhcCCCCCCCCCCCCHHHHHHHHHHHHHHHHh-cCCCeEEEEcChHHHHHHHHH
Q 018441 149 REIDLYSFQGLLKHEGKTKFGPAYRQWQVNPANFSIDGHYPVRELWARARNCWTKILA-HESKSVLVVAHNAVNQALVAT 227 (356)
Q Consensus 149 ~E~~~g~~eg~~~~e~~~~~~~~~~~w~~~~~~~~~~~~Es~~~~~~R~~~~~~~l~~-~~~~~vlvVsHg~~i~~l~~~ 227 (356)
+|+++|.|+|++.+++++.++..+..|..++..+.+|++||+.++..|+..+++++.+ .++++|||||||++|++++++
T Consensus 81 ~E~~~g~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~gEs~~~~~~Rv~~~l~~l~~~~~~~~vlvVsHg~~i~~l~~~ 160 (207)
T d1h2ea_ 81 REIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAA 160 (207)
T ss_dssp SCCCCGGGTTCBHHHHHHHCHHHHHHHHHCGGGCCCSSSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEECHHHHHHHHHH
T ss_pred cccCCCcccccccccccccccccccccccCCccccccCCcccccccccchhHHHhhhhccCCCeEEEEECHHHHHHHHHH
Confidence 9999999999999999999999999999998888999999999999999999999987 777899999999999999999
Q ss_pred HhCCCccchhcc-ccCCccEEEEEEecCCCCCCceEEeccccCCCCCc
Q 018441 228 AIGLGTGFFRIL-LQSNCGVSVLDFTPSVDGGSPHICLNRLNQTPNSP 274 (356)
Q Consensus 228 l~g~~~~~~~~~-~~~n~si~~l~~~~~~~~~~~~~~~~~~N~~~~~p 274 (356)
++|.+...+..+ ..+||+|++|++.++ .|.+..+|++.|+.
T Consensus 161 l~~~~~~~~~~~~~~~n~sit~~~~~~~------~~~l~~~n~~~HL~ 202 (207)
T d1h2ea_ 161 FKDTPLDHLWSPPYMYGTSVTIIEVDGG------TFHVAVEGDVSHIE 202 (207)
T ss_dssp HTTCCGGGTTCSCCCCTTCEEEEEEETT------EEEEEEEEECTTCS
T ss_pred HhCCCHHHHhhccCCCCceEEEEEEECC------EEEEEEEeCHHHhh
Confidence 999998776665 568999999999754 36899999999975
|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} | Back information, alignment and structure |
|---|
| >d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} | Back information, alignment and structure |
|---|
| >d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|