Citrus Sinensis ID: 018444

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------

MLVKPLLKDNRQVNLGRDGLTHNMLELIHSHWKRRRVIKIKCKGVPTVDMDNVCRRLEEKTGGKIIFRVGGLVYLFRGRNYNYRTRPQYPLMLWKPAAPVYPKLIQEAPEGLTKHEADELRRKGKSLLPICKLAKNGVYLTLVRDVRNAFEGSSLVKVNCKGMHASDYKKLGAKLKELVPCVLLSFDDEQILMWRGKDWKSMYPEPPSFSNPVDLDIAGDADGSGTPSDDPSQGTIRSSPKMISLWKRAIESTKALVLDEINLGPDDLLKKVEEFEGISQAAEHSYPALVLSREDGASSSMAEYEDGSQSENYDEDEFYPEDDFNDDDEFYDSDSSDVVPLGSLPVDHIAERLQRK

cccccHHHccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHcccccEEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcc

*L*******N**VNLGRDGLTHNMLELIHSHWKRRRVIKIKCKGVPTVDMDNVCRRLEEKTGGKIIFRVGGLVYLFRGRNYNYRTRPQYPLMLWKPAAPVYPKLIQE****************GKSLLPICKLAKNGVYLTLVRDVRNAFEGSSLVKVNCKGMHASDYKKLGAKLKELVPCVLLSFDDEQILMWRGKDWKSM****************************************ISLWKRAIESTKALVLDEINLGPDDLLKKVEEFEGI*****************************************************************LPVDH*AERL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CRS2-associated factor 2, chloroplastic	Essential protein required for the splicing of group IIB introns in chloroplasts. Forms splicing particles with CRS2. Interacts with RNA and confers intron specificity of the splicing particles.	probable	Q9LDA9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JO0, chain A
Confidence level:very confident
Coverage over the Query: 111-197
View the alignment between query and template
View the model in PyMOL

Template: 1JO0, chain A
Confidence level:very confident
Coverage over the Query: 2-80
View the alignment between query and template
View the model in PyMOL