Citrus Sinensis ID: 018449

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MASTEDVKSESAVTTIVNLAEEAKLAREGVKAPSHALLSVTKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWLIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTGDGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVEMRISD

ccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHccccHHHHHHHHHHHHHHHcccccccc

*ASTEDVKSESAVTTIVNLAEEAK**************SVTKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWLIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDA*******GKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial adenine nucleotide transporter ADNT1	Mitochondrial adenylate carrier that catalyzes specifically the transport of ATP, ADP and AMP by a counter-exchange mechanism across the inner mitochondrial membrane. Substrate preference in reconstituted proteoliposomes is ATP > AMP > ADP. May play a role in oxidative phosphorylation and be important for the provision of energy required to support growth in heterotrophic tissues.	confident	O04619
Uncharacterized mitochondrial carrier YPR011C		probable	Q12251

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 36-282,294-343
View the alignment between query and template
View the model in PyMOL