Citrus Sinensis ID: 018475

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MTIISCLRTVSKPSLISQFSKPKPKTQQSCSLVVSSIVMSYDKELAAAKKAASLAARLCLKVQKALLQSDVQSKNDKSPVTVADYGSQALVSFALQKEFPSEPFSLVAEEDSKDLRQDGAQETLERITKLVNETLASDGAYNTSTLSTEDVIRAIDGGKSEGGSHGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVLACPNLPLASIVGDNQHSSNNEVGCLFFAQVGAGTYMQSLSGSLPVKVQVTAIENSEEASFFESYEAAHSNRDLSSLIAKKLGVKAPPVRIDSQAKYGALSRGDGAIYLRFPRKGYREKIWDHAAGSIVVTGIEIILCYILAYLLSHNSVCRD
ccEEEEHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccEEEEccccccccccccccEEEEEEEEEccEEEEEEEEccccccccccccccccccccccEEEEEEEccCEEEECccccccEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHcccccccCECccHHHHHHHHccccCEEEEcccccccccccccHHHHHHHHccccEEEccccccccccccccc
***ISCLRTVS********************LVVSSIVMSYDKELAAAKKAASLAARLCLKVQKALL******KNDKSPVTVADYGSQALVSFALQKEFPSEPFSLVAEEDSKDLR*DGAQETLERITKLVNETLASDGAYNTSTLSTEDVIRAIDGGKSEGGSHGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVLACPNLPLASIVGDNQHSSNNEVGCLFFAQVGAGTYMQSLSGSLPVKVQVTAIE******FF*************SLIAKKLGVKAPPVRIDSQAKYGALSRGDGAIYLRFPRKGYREKIWDHAAGSIVVTGIEIILCYILAYLLSH******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIISCLRTVSKPSLISQFSKPKPKTQQSCSLVVSSIVMSYDKELAAAKKAASLAARLCLKVQKALLQSDVQSKNDKSPVTVADYGSQALVSFALQKEFPSEPFSLVAEEDSKDLRQDGAQETLERITKLVNETLASDGAYNTSTLSTEDVIRAIDGGKSEGGSHGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVLACPNLPLASIVGDNQHSSNNEVGCLFFAQVGAGTYMQSLSGSLPVKVQVTAIENSEEASFFESYEAAHSNRDLSSLIAKKLGVKAPPVRIDSQAKYGALSRGDGAIYLRFPRKGYREKIWDHAAGSIVVTGIEIILCYILAYLLSHNSVCRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3'(2'),5'-bisphosphate nucleotidase Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS.probableP0C5A3
3'(2'),5'-bisphosphate nucleotidase Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS.probableQ2QWT4
SAL1 phosphatase Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. May regulate the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. May play a role in the biosynthesis of sulfate conjugates and RNA processing. Is also able to hydrolyze inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate. Could be considered as a negative regulator of abscisic acid (ABA)- and stress-responsive genes, through modulating the inositol 1,4,5-trisphosphate (IP3) turnover. Is also involved in salt tolerance. Acts as a suppressor of virus-and transgene-induced silencing.probableQ42546

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.73'(2'),5'-bisphosphate nucleotidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P3N, chain A
Confidence level:very confident
Coverage over the Query: 43-114,164-208,226-350
View the alignment between query and template
View the model in PyMOL
Template: 1KA1, chain A
Confidence level:very confident
Coverage over the Query: 40-350
View the alignment between query and template
View the model in PyMOL