Citrus Sinensis ID: 018525


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MPIFKFQGKFNQKNTTMLLRLPFFSASRNSSGMLARVKSEIVQSSIKAQQLLSKGRRVFPHQGSVKFVQTSWRMSIPGLPSSRHEDKAPASPKVLRDKKAVPDADPPSIEDINQLYQFFDNSAKLIVLTGAGISTECGIPDYRSPNGAYSSGFKPITHQQFVRSSRARRRYWARSYAGWRRFMAAQPNPAHFALASLEKAGRIDCMITQNVDRLHHRAGSNPLELHGTVYTVVCLDCGFSFCRDLFQDQVKALNPKWAEAIESLDYGSPGSDRSFGMKQRPDGDIEIDEKFWEEDFHIPTCQKCNGVLKPDVVFFGDNVPKDRADKAMEAAKECDAFLVLGSSLMTMSAYRLVR
cccccccccccccccCEEEECccccccccccccccccHHHHHHHHHHHHHHHHccccccccccCEEEEHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccEEccccccHHHHcccccEEccccccEEEEccccccccHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccEEEEEcccHHHcccccccc
*PIFKF*GKFNQKNTTMLLRLPFFSASRNSSGMLARVKSEI***************RVFPHQGSVKFVQTSWRMSIPGLP******************************DINQLYQFFDNSAKLIVLTGAGISTECGIPDYRSPNGAYSSGFKPITHQQFVRSSRARRRYWARSYAGWRRFMAAQPNPAHFALASLEKAGRIDCMITQNVDRLHHRAGSNPLELHGTVYTVVCLDCGFSFCRDLFQDQVKALNPKWAEAIESL*****************DGDIEIDEKFWEEDFHIPTCQKCNGVLKPDVVFFGDNVPKDRADKAMEAAKECDAFLVLGSSLMTMSAYRLVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIFKFQGKFNQKNTTMLLRLPFFSASRNSSGMLARVKSEIVQSSIKAQQLLSKGRRVFPHQGSVKFVQTSWRMSIPGLPSSRHEDKAPASPKVLRDKKAVPDADPPSIEDINQLYQFFDNSAKLIVLTGAGISTECGIPDYRSPNGAYSSGFKPITHQQFVRSSRARRRYWARSYAGWRRFMAAQPNPAHFALASLEKAGRIDCMITQNVDRLHHRAGSNPLELHGTVYTVVCLDCGFSFCRDLFQDQVKALNPKWAEAIESLDYGSPGSDRSFGMKQRPDGDIEIDEKFWEEDFHIPTCQKCNGVLKPDVVFFGDNVPKDRADKAMEAAKECDAFLVLGSSLMTMSAYRLVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacetylase SRT2 NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form (By similarity). Negatively regulates plant basal defense against plant pathogens, possibly by suppressing salicylic acid biosynthesis.confidentQ94AQ6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HJH, chain A
Confidence level:very confident
Coverage over the Query: 110-258,272-276,296-353
View the alignment between query and template
View the model in PyMOL
Template: 3JWP, chain A
Confidence level:probable
Coverage over the Query: 105-237,248-269,299-352
View the alignment between query and template
View the model in PyMOL