Citrus Sinensis ID: 018532

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MRTKTPLKQLKLSVPVQETPITSFLTASGTFHDGDLLLNQKGLRLISEENESRPSDYKEFDFEFSLEDLETIKVIGKGSGGVVQLVRHKWVGRLFALKIIQMNIQEEIRKQIVQELKINQASQCSHVVVCYHSFYHNGVISLVLEYMDRGSLADIIRQVKTILEPYLAVVCKQVLQGLVYLHNERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLGSSMGQRDTFVGTYNYMSPERISGSTYDYSSDIWSLGLVVLECAIGRFPYMQSEDQQSWPSFYELLEAIVESPPPTAPPDQFSPEFCSFVSACIQKDPRDRSSSLDLLSHPFIKKFEDKDIDLGILVGSLDPPVNCPR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEECccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccHHHccccccccHHHHHHHccccccccc
*************************************************************FEFSLEDLETIKVIGKGSGGVVQLVRHKWVGRLFALKIIQMNIQEEIRKQIVQELKINQASQCSHVVVCYHSFYHNGVISLVLEYMDRGSLADIIRQVKTILEPYLAVVCKQVLQGLVYLHNERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLGSSMGQRDTFVGTYNYMSPERISGSTYDYSSDIWSLGLVVLECAIGRFPYMQSEDQQSWPSFYELLEAIVESPPPT****QFSPEFCSFVSACIQKDPRDRSSSLDLLSHPFIKKFEDKDIDLGILVGSLDPPV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTKTPLKQLKLSVPVQETPITSFLTASGTFHDGDLLLNQKGLRLISEENESRPSDYKEFDFEFSLEDLETIKVIGKGSGGVVQLVRHKWVGRLFALKIIQMNIQEEIRKQIVQELKINQASQCSHVVVCYHSFYHNGVISLVLEYMDRGSLADIIRQVKTILEPYLAVVCKQVLQGLVYLHNERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLGSSMGQRDTFVGTYNYMSPERISGSTYDYSSDIWSLGLVVLECAIGRFPYMQSEDQQSWPSFYELLEAIVESPPPTAPPDQFSPEFCSFVSACIQKDPRDRSSSLDLLSHPFIKKFEDKDIDLGILVGSLDPPVNCPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase kinase 1 confidentQ5QN75
Mitogen-activated protein kinase kinase 6 Involved in the regulation of plant cytokinesis during meiosis and mitosis. Activates MPK13 in vitro.confidentQ9FJV0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.12.-Dual-specificity kinases (those acting on Ser/Thr and Tyr residues).probable
2.7.12.2Mitogen-activated protein kinase kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EQC, chain A
Confidence level:very confident
Coverage over the Query: 63-343
View the alignment between query and template
View the model in PyMOL
Template: 3G51, chain A
Confidence level:confident
Coverage over the Query: 43-217,229-338
View the alignment between query and template
View the model in PyMOL