Citrus Sinensis ID: 018533

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MPRPYFHKLILASTIRDKRLRIPENFVRNFKDDLSAAATLIVPNGMVSRVGLRRLDNKVWFYDGWQEFMERYFIRIGYFLVFRYEGNSAFNVYIFNLPSSEINYQPNALSNFEVPNHSKQYHIFAEMEDDDSEHVDQPTVNKTFNPPSFQNLLNSSKLSNSINGAGEANLQRLKVKLYSQDGETPKLKKPGRKRKIDPNVQASSAQEVHDGEMQFRFYESASARKRTVTAEERERAINAAKAFEPSNPFCRVVLRPSYLYKGCIMYLPSCFAEKHLNGVCGFIKLQLSDGKQWPVRCLYRGGRAKFSQGWYEFTVENRLGEGDVCVFEVLRAREFVLKVTVFRVSESAGFMSRH

cccccEEEEEcccccccccccccHHHHHHccccccccEEEEcccccEEEEEEEECccEEEEcccHHHHHHHHccccccEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHccccccEEEEEcccccccccccccccHHHHHHcccccccEEEEECccccEEEEEEEECccCEEEcccHHHHHHHcccccccEEEEEEEEccEEEEEEEEEEEcccccccccc

*PRPYFHKLILASTIRDKRLRIPENFVRNFKDDLSAAATLIVPNGMVSRVGLRRLDNKVWFYDGWQEFMERYFIRIGYFLVFRYEGNSAFNVYIFNLPSSEINYQPNALSNFE***************************NKTFNPPSFQNLLNSSKLSNSINGAGEANLQRLKVKLYSQDGETPKLKKPGRKRKIDPNVQASSAQEVHDGEMQFRFYESA******VTAEERERAINAAKAFEPSNPFCRVVLRPSYLYKGCIMYLPSCFAEKHLNGVCGFIKLQLSDGKQWPVRCLYRGGRAKFSQGWYEFTVENRLGEGDVCVFEVLRAREFVLKVTVFRVS*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
B3 domain-containing transcription factor VRN1	Involved in the regulation of vernalization. Acts as transcriptional repressor of FLC, a major target of the vernalization pathway. Binds DNA in vitro in a non-sequence-specific manner.	probable	Q8L3W1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4I1K, chain A
Confidence level:very confident
Coverage over the Query: 227-345
View the alignment between query and template
View the model in PyMOL

Template: 1YEL, chain A
Confidence level:very confident
Coverage over the Query: 2-100
View the alignment between query and template
View the model in PyMOL