Query         018539
Match_columns 354
No_of_seqs    115 out of 136
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 09:51:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/018539.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/018539hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0 1.1E-71 2.4E-76  502.5   8.4  169  115-284     1-180 (180)
  2 COG1512 Beta-propeller domains  81.6     1.6 3.4E-05   42.9   3.6    8   83-90    257-264 (271)
  3 KOG3973 Uncharacterized conser  73.3       7 0.00015   40.4   5.6   15   70-84    361-375 (465)
  4 PHA00370 III attachment protei  72.7     5.4 0.00012   39.5   4.5   13  246-258   236-248 (297)
  5 PHA00370 III attachment protei  68.3     6.4 0.00014   39.1   4.0   14  186-200   239-252 (297)
  6 KOG0921 Dosage compensation co  63.6     7.3 0.00016   44.7   3.8   14   82-95   1247-1260(1282)
  7 KOG3915 Transcription regulato  62.4     7.2 0.00016   41.6   3.3   14  152-165   202-215 (641)
  8 PTZ00146 fibrillarin; Provisio  61.4      13 0.00028   37.0   4.7    9  152-160   108-116 (293)
  9 PTZ00146 fibrillarin; Provisio  58.7      16 0.00034   36.4   4.8   14  223-236   139-152 (293)
 10 PF05918 API5:  Apoptosis inhib  58.5     3.2   7E-05   44.5   0.0   13   57-69    516-528 (556)
 11 KOG4096 Uncharacterized conser  54.0     2.1 4.6E-05   34.9  -1.7   56  222-277    16-71  (75)
 12 PRK05325 hypothetical protein;  44.4      36 0.00078   35.4   4.9   14  310-323   357-370 (401)
 13 COG4704 Uncharacterized protei  43.4      21 0.00045   32.6   2.6   34   33-66    107-140 (151)
 14 COG3064 TolA Membrane protein   43.4      24 0.00052   36.2   3.3   43  104-146   304-346 (387)
 15 PF10247 Romo1:  Reactive mitoc  40.5      21 0.00045   28.6   2.0   52  221-276    15-66  (67)
 16 PF05918 API5:  Apoptosis inhib  38.8      10 0.00022   40.8   0.0   12   55-66    517-528 (556)
 17 TIGR02877 spore_yhbH sporulati  34.7      62  0.0013   33.5   4.8   16   49-64     51-66  (371)
 18 KOG4307 RNA binding protein RB  33.0 1.7E+02  0.0037   33.2   7.9   31  105-135   857-887 (944)
 19 PF09579 Spore_YtfJ:  Sporulati  30.6      29 0.00063   28.4   1.4   13   61-73     14-26  (83)
 20 COG4371 Predicted membrane pro  30.1      57  0.0012   32.8   3.5   12  147-158   157-168 (334)
 21 PF01102 Glycophorin_A:  Glycop  29.6      56  0.0012   28.8   3.1   27  218-245    66-92  (122)
 22 KOG3915 Transcription regulato  29.4      43 0.00093   36.1   2.7   10   49-58     38-47  (641)
 23 PF13677 MotB_plug:  Membrane M  27.6      81  0.0018   24.0   3.3   29  151-179    14-42  (58)
 24 PF07096 DUF1358:  Protein of u  26.6      80  0.0017   28.2   3.5   57  214-272    28-92  (124)
 25 KOG0105 Alternative splicing f  26.6 1.4E+02  0.0031   28.9   5.4   13   60-72     76-88  (241)
 26 KOG3074 Transcriptional regula  25.8      49  0.0011   32.7   2.2    8  265-272   199-206 (263)
 27 PF15207 TMEM240:  TMEM240 fami  22.8      90  0.0019   28.9   3.2   25  150-175    84-108 (180)
 28 PF04285 DUF444:  Protein of un  22.5 1.6E+02  0.0034   31.0   5.3    8  315-322   384-391 (421)
 29 KOG1596 Fibrillarin and relate  22.3 1.3E+02  0.0027   30.4   4.3   20  149-168   132-151 (317)
 30 PRK12799 motB flagellar motor   21.1      68  0.0015   33.6   2.4   28  152-179    25-52  (421)
 31 PLN03134 glycine-rich RNA-bind  20.7 1.2E+02  0.0026   26.6   3.5   40   50-89    104-143 (144)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=1.1e-71  Score=502.51  Aligned_cols=169  Identities=51%  Similarity=0.849  Sum_probs=162.5

Q ss_pred             hhhccCCCchhHHHHHHhhhhheeeeEeeccCCCcchhHHHHHHHhhhHHHHHHHHhhhhcccccccC---C----CCCc
Q 018539          115 SRVAADPQFPFKVLMEQLVGVTACVIGDMASRPNFGLNELDFVFSTLVVGSIMNFTLMYLLAPTLSAA---P----QNLP  187 (354)
Q Consensus       115 ~RlLADP~FlfKL~~E~vI~i~~~v~aE~~~R~~~f~~ElDfV~sdvv~gsv~nf~LVwlLAPt~s~s---a----~~l~  187 (354)
                      |||||||+|||||++||+||++|+++|||++|+|+||+|||||+||+++++|+||+||||||||++..   .    ..++
T Consensus         1 ~RllADP~Fl~Kl~~E~~i~i~~~~~~e~~~R~e~f~~E~d~v~~d~v~~~i~n~~lv~llAPt~s~~~~~~~~~~~~~~   80 (180)
T PF11891_consen    1 ERLLADPSFLFKLAIEEVIGIGCATAAEYAKRGERFWNELDFVFSDVVVGSIVNFALVWLLAPTRSFGSPAASSPGGGLQ   80 (180)
T ss_pred             CcccccchHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHHHHHHHHhccchHhhCcccccccchHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999941   1    3578


Q ss_pred             cccccCCCCCccCCC----CCchhhhHHHHhhcchhhhhhhhhHhHHHHHHHHHHHHHhhhcCCCCCCCCCCCchhhhHH
Q 018539          188 GLFASCPTSHMFEPG----AFSFANRLGTFVFKGLVFASVGFAAGLVGTAISNGLIKLRKKMDPAFETPNKPPPTVLNAL  263 (354)
Q Consensus       188 ~~f~s~Ppnn~Fe~~----~fsl~qR~~a~v~KGa~l~~VG~~aGlvG~~lsN~Li~~Rk~~d~s~e~~~~~pPvl~tAl  263 (354)
                      ++|++|| +|+||++    +||++||++||+|||++|++|||+||++|+++||+|+++||++||+||.++++|||++||+
T Consensus        81 ~~~~~~P-~n~Fq~~~~g~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~~rk~~~~~~e~~~~~ppv~~ta~  159 (180)
T PF11891_consen   81 KFLGSLP-NNAFQKGYPGRSFSLAQRIGAFVYKGAKLAAVGFIAGLVGTGLSNALIAARKKVDPSFEPSVPVPPVLKTAL  159 (180)
T ss_pred             HHHHhCh-HHHhccCCCCCcccHHHHHHHHHHcchHhhhhHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCCCHHHHHH
Confidence            8999999 6899986    4999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccchhhHHHHHhHH
Q 018539          264 TWSLHMGISSNFRYQTLNGIE  284 (354)
Q Consensus       264 ~wg~fMGvSSNlRYQil~GiE  284 (354)
                      +||+|||+|||+|||+|||+|
T Consensus       160 ~~g~fmGvSsNlRYQil~GiE  180 (180)
T PF11891_consen  160 GWGAFMGVSSNLRYQILNGIE  180 (180)
T ss_pred             HHHHHHhhhHhHHHHHHcCCC
Confidence            999999999999999999997


No 2  
>COG1512 Beta-propeller domains of methanol dehydrogenase type [General function prediction only]
Probab=81.55  E-value=1.6  Score=42.91  Aligned_cols=8  Identities=75%  Similarity=1.485  Sum_probs=3.6

Q ss_pred             CCCCCCCC
Q 018539           83 GGGDGSGG   90 (354)
Q Consensus        83 ggg~~~gg   90 (354)
                      |||+++||
T Consensus       257 gGGgS~GG  264 (271)
T COG1512         257 GGGGSSGG  264 (271)
T ss_pred             CCCCCCCC
Confidence            44444444


No 3  
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=73.27  E-value=7  Score=40.44  Aligned_cols=15  Identities=60%  Similarity=1.061  Sum_probs=6.4

Q ss_pred             CCCCCCCCCCCCCCC
Q 018539           70 GSYGTGHGKGGGGGG   84 (354)
Q Consensus        70 g~~g~~gg~~ggggg   84 (354)
                      |++|+-||.|||-||
T Consensus       361 g~Gg~~gGrGgGRGg  375 (465)
T KOG3973|consen  361 GSGGNWGGRGGGRGG  375 (465)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            344444444444443


No 4  
>PHA00370 III attachment protein
Probab=72.75  E-value=5.4  Score=39.53  Aligned_cols=13  Identities=15%  Similarity=0.276  Sum_probs=5.3

Q ss_pred             CCCCCCCCCCCch
Q 018539          246 DPAFETPNKPPPT  258 (354)
Q Consensus       246 d~s~e~~~~~pPv  258 (354)
                      .|++...+..||.
T Consensus       236 ~PslP~~n~C~~F  248 (297)
T PHA00370        236 RPSLPEGHGCTPF  248 (297)
T ss_pred             ccCCCCCCCCCcc
Confidence            3444433444443


No 5  
>PHA00370 III attachment protein
Probab=68.31  E-value=6.4  Score=39.06  Aligned_cols=14  Identities=21%  Similarity=0.332  Sum_probs=7.0

Q ss_pred             CccccccCCCCCccC
Q 018539          186 LPGLFASCPTSHMFE  200 (354)
Q Consensus       186 l~~~f~s~Ppnn~Fe  200 (354)
                      ||.- ..|||=-+||
T Consensus       239 lP~~-n~C~~FV~~~  252 (297)
T PHA00370        239 LPEG-HGCTPFVFAQ  252 (297)
T ss_pred             CCCC-CCCCcceeec
Confidence            4433 5777643334


No 6  
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=63.63  E-value=7.3  Score=44.66  Aligned_cols=14  Identities=64%  Similarity=1.203  Sum_probs=6.4

Q ss_pred             CCCCCCCCCCCCCC
Q 018539           82 GGGGDGSGGFSGDG   95 (354)
Q Consensus        82 gggg~~~gg~~~d~   95 (354)
                      |||+-++|||++..
T Consensus      1247 gggyrgsGGfgrgg 1260 (1282)
T KOG0921|consen 1247 GGGYRGSGGFGRGG 1260 (1282)
T ss_pred             CCCccCCCCcCCCC
Confidence            33344455554433


No 7  
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=62.44  E-value=7.2  Score=41.62  Aligned_cols=14  Identities=29%  Similarity=0.475  Sum_probs=10.2

Q ss_pred             hHHHHHHHhhhHHH
Q 018539          152 NELDFVFSTLVVGS  165 (354)
Q Consensus       152 ~ElDfV~sdvv~gs  165 (354)
                      +-+|+++=.+|-++
T Consensus       202 QafdlFLKhlVGGL  215 (641)
T KOG3915|consen  202 QAFDLFLKHLVGGL  215 (641)
T ss_pred             HHHHHHHHHHhchH
Confidence            56888888877554


No 8  
>PTZ00146 fibrillarin; Provisional
Probab=61.43  E-value=13  Score=37.01  Aligned_cols=9  Identities=11%  Similarity=-0.171  Sum_probs=3.5

Q ss_pred             hHHHHHHHh
Q 018539          152 NELDFVFST  160 (354)
Q Consensus       152 ~ElDfV~sd  160 (354)
                      .+||=+=|-
T Consensus       108 R~w~p~rSK  116 (293)
T PTZ00146        108 RVWNPFRSK  116 (293)
T ss_pred             eeeCCcccH
Confidence            344433333


No 9  
>PTZ00146 fibrillarin; Provisional
Probab=58.66  E-value=16  Score=36.38  Aligned_cols=14  Identities=29%  Similarity=0.472  Sum_probs=6.0

Q ss_pred             hhhhHhHHHHHHHH
Q 018539          223 VGFAAGLVGTAISN  236 (354)
Q Consensus       223 VG~~aGlvG~~lsN  236 (354)
                      +|...|.....++.
T Consensus       139 LGaG~G~~t~~lAd  152 (293)
T PTZ00146        139 LGAASGTTVSHVSD  152 (293)
T ss_pred             eCCcCCHHHHHHHH
Confidence            34444444444443


No 10 
>PF05918 API5:  Apoptosis inhibitory protein 5 (API5);  InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterised by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in Homo sapiens chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors [,].; PDB: 3U0R_A 3V6A_A.
Probab=58.46  E-value=3.2  Score=44.51  Aligned_cols=13  Identities=46%  Similarity=0.731  Sum_probs=0.0

Q ss_pred             CCCceeeccCCCC
Q 018539           57 SPPRFELSSTGGG   69 (354)
Q Consensus        57 ~~~~~~~~~~g~~   69 (354)
                      .+|+.+.+.-+++
T Consensus       516 ~~p~~k~ss~~~~  528 (556)
T PF05918_consen  516 VPPSGKYSSNGGN  528 (556)
T ss_dssp             -------------
T ss_pred             CCCCCCCcCCCCC
Confidence            5677775544433


No 11 
>KOG4096 consensus Uncharacterized conserved protein [Function unknown]
Probab=54.03  E-value=2.1  Score=34.95  Aligned_cols=56  Identities=27%  Similarity=0.207  Sum_probs=34.4

Q ss_pred             hhhhhHhHHHHHHHHHHHHHhhhcCCCCCCCCCCCchhhhHHHHHHHhhccchhhH
Q 018539          222 SVGFAAGLVGTAISNGLIKLRKKMDPAFETPNKPPPTVLNALTWSLHMGISSNFRY  277 (354)
Q Consensus       222 ~VG~~aGlvG~~lsN~Li~~Rk~~d~s~e~~~~~pPvl~tAl~wg~fMGvSSNlRY  277 (354)
                      .+|+..|....++=-....+|-.+.+.--....-.-++.+|.++|+||++-+-+||
T Consensus        16 ~mG~avG~a~G~lfGgf~~lR~g~~g~~~vr~iGkt~~~SagtFG~FM~igs~Ir~   71 (75)
T KOG4096|consen   16 MMGGAVGGATGALFGGFAALRYGPRGRGLVRTIGKTMLQSAGTFGLFMGIGSGIRC   71 (75)
T ss_pred             HHHhhhhhhhhhhccchhheeecCChhHHHHHHhHHHHhccchhhhhhhhhhheec
Confidence            34444444444444444557766655322222224578899999999999998887


No 12 
>PRK05325 hypothetical protein; Provisional
Probab=44.38  E-value=36  Score=35.44  Aligned_cols=14  Identities=7%  Similarity=-0.019  Sum_probs=9.7

Q ss_pred             hhhHHHHHHHHHhc
Q 018539          310 LGGMSFVLLARMTG  323 (354)
Q Consensus       310 lG~~~fVd~AR~tG  323 (354)
                      ..+..|-.|.+...
T Consensus       357 ~~~~l~~~y~~i~~  370 (401)
T PRK05325        357 RHQTLWREYERLQD  370 (401)
T ss_pred             CchHHHHHHHHhhc
Confidence            56778888876544


No 13 
>COG4704 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.43  E-value=21  Score=32.63  Aligned_cols=34  Identities=26%  Similarity=0.517  Sum_probs=29.7

Q ss_pred             CCCCCCCCCCccCCCccceecccCCCCceeeccC
Q 018539           33 PYRLPNNPASFSQNHSLSILHSKVSPPRFELSST   66 (354)
Q Consensus        33 ~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   66 (354)
                      +|-+|.-|++|+||++.|.=.++|+.-.+...||
T Consensus       107 ~fGiP~EpfGfSrna~~rtg~PaF~dAAf~v~~~  140 (151)
T COG4704         107 PFGIPKEPFGFSRNASIRTGPPAFSDAAFTVTGG  140 (151)
T ss_pred             CCCCccCCcccccCCccccCCCcccceeEEEecC
Confidence            5788999999999999999999998888887654


No 14 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=43.41  E-value=24  Score=36.21  Aligned_cols=43  Identities=14%  Similarity=0.026  Sum_probs=30.5

Q ss_pred             ChhHHHHHhhhhhhccCCCchhHHHHHHhhhhheeeeEeeccC
Q 018539          104 GIWGLWLNGWRSRVAADPQFPFKVLMEQLVGVTACVIGDMASR  146 (354)
Q Consensus       104 g~~~~~~~GfR~RlLADP~FlfKL~~E~vI~i~~~v~aE~~~R  146 (354)
                      ...|-+-+.++.|+|-+|+|--|.|.=.+--+=..++..|+.-
T Consensus       304 ~Yag~ik~~Iq~rfl~~~sf~gK~C~l~ikL~pdGtl~~~~~~  346 (387)
T COG3064         304 QYAGQIKSAIQSRFLDADSFAGKTCRLRIKLAPDGTLLDIKPE  346 (387)
T ss_pred             HHHHHHHHHHHHHHhcccccCCceeEEEEEEcCCcceeecccc
Confidence            5567778889999999999999876433333334456777665


No 15 
>PF10247 Romo1:  Reactive mitochondrial oxygen species modulator 1;  InterPro: IPR018450 The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression.  This entry contains the mitochondrial protein, reactive oxygen species modulator 1 (Romo1), that is responsible for increasing the level of ROS in cells. In various cancer cell lines with elevated levels of ROS there is also an increased abundance of Romo1 []. Increased Romo1 expression can have a number of other affects including: inducing premature senescence of cultured human fibroblasts [, ] and increased resistance to 5-fluorouracil [].
Probab=40.53  E-value=21  Score=28.61  Aligned_cols=52  Identities=21%  Similarity=0.098  Sum_probs=34.5

Q ss_pred             hhhhhhHhHHHHHHHHHHHHHhhhcCCCCCCCCCCCchhhhHHHHHHHhhccchhh
Q 018539          221 ASVGFAAGLVGTAISNGLIKLRKKMDPAFETPNKPPPTVLNALTWSLHMGISSNFR  276 (354)
Q Consensus       221 ~~VG~~aGlvG~~lsN~Li~~Rk~~d~s~e~~~~~pPvl~tAl~wg~fMGvSSNlR  276 (354)
                      ++||.+.|++-...+    .+|.+..+..-......-++.++.++|.||++=+=+|
T Consensus        15 ~~VG~~~G~l~G~~~----~~r~g~~~~~~~~~lg~~~l~sg~tFG~Fm~iGs~IR   66 (67)
T PF10247_consen   15 GAVGGAFGALFGTFS----AFRYGARGRGLMRTLGKYMLGSGATFGFFMSIGSVIR   66 (67)
T ss_pred             hHHHhhhhhhhhhHH----HhccCCCCcchHhHHhHHHhcchhHHHHHHhhhcccc
Confidence            456666666555444    4677766544333344567889999999999977665


No 16 
>PF05918 API5:  Apoptosis inhibitory protein 5 (API5);  InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterised by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in Homo sapiens chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors [,].; PDB: 3U0R_A 3V6A_A.
Probab=38.76  E-value=10  Score=40.84  Aligned_cols=12  Identities=8%  Similarity=-0.233  Sum_probs=0.0

Q ss_pred             cCCCCceeeccC
Q 018539           55 KVSPPRFELSST   66 (354)
Q Consensus        55 ~~~~~~~~~~~~   66 (354)
                      +++-.+..-+++
T Consensus       517 ~p~~k~ss~~~~  528 (556)
T PF05918_consen  517 PPSGKYSSNGGN  528 (556)
T ss_dssp             ------------
T ss_pred             CCCCCCcCCCCC
Confidence            334444444444


No 17 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=34.67  E-value=62  Score=33.52  Aligned_cols=16  Identities=13%  Similarity=0.233  Sum_probs=7.8

Q ss_pred             cceecccCCCCceeec
Q 018539           49 LSILHSKVSPPRFELS   64 (354)
Q Consensus        49 ~~~~~~~~~~~~~~~~   64 (354)
                      ++|=-..+++|++..+
T Consensus        51 V~IPir~l~Ep~F~~g   66 (371)
T TIGR02877        51 IKVPIRGLKEYRFRYD   66 (371)
T ss_pred             EEccCCCCccceEEeC
Confidence            3333333456666655


No 18 
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]
Probab=32.96  E-value=1.7e+02  Score=33.23  Aligned_cols=31  Identities=26%  Similarity=0.320  Sum_probs=20.0

Q ss_pred             hhHHHHHhhhhhhccCCCchhHHHHHHhhhh
Q 018539          105 IWGLWLNGWRSRVAADPQFPFKVLMEQLVGV  135 (354)
Q Consensus       105 ~~~~~~~GfR~RlLADP~FlfKL~~E~vI~i  135 (354)
                      ++.-.+.--==|+++=-.|+||+-+|.+++.
T Consensus       857 ~~~~~~~~pGp~V~~~~n~Pf~v~l~dI~~F  887 (944)
T KOG4307|consen  857 ELMELIKSPGPRVLSCNNFPFDVTLEDIVEF  887 (944)
T ss_pred             HHHHhcCCCCCeEEEecCCCccccHHHHHHH
Confidence            3333333333358888888888888888776


No 19 
>PF09579 Spore_YtfJ:  Sporulation protein YtfJ (Spore_YtfJ);  InterPro: IPR014229 Proteins in this entry, exemplified by YtfJ of Bacillus subtilis, are encoded by bacterial genomes if, and only if, the species is capable of endospore formation. YtfJ was confirmed in spores of B. subtilis; it appears to be expressed in the forespore under control of SigF [].
Probab=30.60  E-value=29  Score=28.37  Aligned_cols=13  Identities=23%  Similarity=0.366  Sum_probs=6.3

Q ss_pred             eeeccCCCCCCCC
Q 018539           61 FELSSTGGGGSYG   73 (354)
Q Consensus        61 ~~~~~~g~~g~~g   73 (354)
                      +++++|+|++...
T Consensus        14 VsfGfG~Gg~~~~   26 (83)
T PF09579_consen   14 VSFGFGAGGGEGK   26 (83)
T ss_pred             EEEEEEEeCCCCC
Confidence            4555555444433


No 20 
>COG4371 Predicted membrane protein [Function unknown]
Probab=30.15  E-value=57  Score=32.80  Aligned_cols=12  Identities=17%  Similarity=-0.022  Sum_probs=7.3

Q ss_pred             CCcchhHHHHHH
Q 018539          147 PNFGLNELDFVF  158 (354)
Q Consensus       147 ~~~f~~ElDfV~  158 (354)
                      .+..+.|+|=..
T Consensus       157 a~elk~eL~~iA  168 (334)
T COG4371         157 ADELKSELQRIA  168 (334)
T ss_pred             hHHHHHHHHHHH
Confidence            345577777554


No 21 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=29.61  E-value=56  Score=28.79  Aligned_cols=27  Identities=19%  Similarity=0.333  Sum_probs=17.5

Q ss_pred             hhhhhhhhhHhHHHHHHHHHHHHHhhhc
Q 018539          218 LVFASVGFAAGLVGTAISNGLIKLRKKM  245 (354)
Q Consensus       218 a~l~~VG~~aGlvG~~lsN~Li~~Rk~~  245 (354)
                      .-+-.+|.+||+||.-+--..+ +||..
T Consensus        66 i~~Ii~gv~aGvIg~Illi~y~-irR~~   92 (122)
T PF01102_consen   66 IIGIIFGVMAGVIGIILLISYC-IRRLR   92 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH-HHHHS
T ss_pred             eeehhHHHHHHHHHHHHHHHHH-HHHHh
Confidence            3455678889999987755544 34443


No 22 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=29.40  E-value=43  Score=36.07  Aligned_cols=10  Identities=20%  Similarity=0.022  Sum_probs=4.2

Q ss_pred             cceecccCCC
Q 018539           49 LSILHSKVSP   58 (354)
Q Consensus        49 ~~~~~~~~~~   58 (354)
                      -.+-|+.|-+
T Consensus        38 a~~~~~~~~~   47 (641)
T KOG3915|consen   38 ASSGPTLFRP   47 (641)
T ss_pred             cccCccccCc
Confidence            3344444433


No 23 
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=27.62  E-value=81  Score=23.98  Aligned_cols=29  Identities=10%  Similarity=0.165  Sum_probs=24.8

Q ss_pred             hhHHHHHHHhhhHHHHHHHHhhhhccccc
Q 018539          151 LNELDFVFSTLVVGSIMNFTLMYLLAPTL  179 (354)
Q Consensus       151 ~~ElDfV~sdvv~gsv~nf~LVwlLAPt~  179 (354)
                      -..|-+-++|+++...+=|+++|.++-+-
T Consensus        14 ~~~WlvtyaDlmTLLl~fFVlL~s~s~~d   42 (58)
T PF13677_consen   14 SPRWLVTYADLMTLLLAFFVLLFSMSSVD   42 (58)
T ss_pred             CccHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            45788999999999999999999887554


No 24 
>PF07096 DUF1358:  Protein of unknown function (DUF1358);  InterPro: IPR009792 This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown.
Probab=26.62  E-value=80  Score=28.21  Aligned_cols=57  Identities=21%  Similarity=0.272  Sum_probs=32.2

Q ss_pred             hhcchhhhhhhhhHhHHHHHHHHHHHHHhhhcCCCCCC--------CCCCCchhhhHHHHHHHhhcc
Q 018539          214 VFKGLVFASVGFAAGLVGTAISNGLIKLRKKMDPAFET--------PNKPPPTVLNALTWSLHMGIS  272 (354)
Q Consensus       214 v~KGa~l~~VG~~aGlvG~~lsN~Li~~Rk~~d~s~e~--------~~~~pPvl~tAl~wg~fMGvS  272 (354)
                      ++.++.|+.|+.++-++|-+.+-+  .+||+-..-|..        +.....+-..||+||..+.+.
T Consensus        28 ~~~~~FL~~Va~~s~~aGF~~tl~--~aKKk~p~~F~kg~~~~~~l~esGasLAlRALgWGTlyA~~   92 (124)
T PF07096_consen   28 IKGGAFLGGVAGASALAGFGTTLA--LAKKKSPKWFSKGISQTKALHESGASLALRALGWGTLYAVC   92 (124)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH--HHHhcCcHHHhccCcCcccCCcchHHHHHHHHhHHHHHHHH
Confidence            344556667877777776665554  356653323321        111222345799999887763


No 25 
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=26.61  E-value=1.4e+02  Score=28.94  Aligned_cols=13  Identities=31%  Similarity=0.394  Sum_probs=7.7

Q ss_pred             ceeeccCCCCCCC
Q 018539           60 RFELSSTGGGGSY   72 (354)
Q Consensus        60 ~~~~~~~g~~g~~   72 (354)
                      ++++..||..++.
T Consensus        76 RVEfprggr~s~~   88 (241)
T KOG0105|consen   76 RVEFPRGGRSSSD   88 (241)
T ss_pred             EEEeccCCCcccc
Confidence            4677777754333


No 26 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=25.84  E-value=49  Score=32.69  Aligned_cols=8  Identities=25%  Similarity=0.306  Sum_probs=4.8

Q ss_pred             HHHHhhcc
Q 018539          265 WSLHMGIS  272 (354)
Q Consensus       265 wg~fMGvS  272 (354)
                      ||.||=+|
T Consensus       199 ~G~f~riS  206 (263)
T KOG3074|consen  199 RGVFVRIS  206 (263)
T ss_pred             ccceEEEE
Confidence            56666655


No 27 
>PF15207 TMEM240:  TMEM240 family
Probab=22.80  E-value=90  Score=28.91  Aligned_cols=25  Identities=20%  Similarity=0.510  Sum_probs=20.0

Q ss_pred             chhHHHHHHHhhhHHHHHHHHhhhhc
Q 018539          150 GLNELDFVFSTLVVGSIMNFTLMYLL  175 (354)
Q Consensus       150 f~~ElDfV~sdvv~gsv~nf~LVwlL  175 (354)
                      -++|+|+++- ++.|.+..-+||||=
T Consensus        84 tkqeidlmlg-lllgfcisw~l~wmd  108 (180)
T PF15207_consen   84 TKQEIDLMLG-LLLGFCISWFLVWMD  108 (180)
T ss_pred             hHHHHHHHHH-HHHHHHHHHHHHHHh
Confidence            4799999874 666888888899973


No 28 
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=22.48  E-value=1.6e+02  Score=31.02  Aligned_cols=8  Identities=0%  Similarity=0.090  Sum_probs=3.9

Q ss_pred             HHHHHHHh
Q 018539          315 FVLLARMT  322 (354)
Q Consensus       315 fVd~AR~t  322 (354)
                      |..+.+..
T Consensus       384 ~~~~~~~~  391 (421)
T PF04285_consen  384 WREYEELK  391 (421)
T ss_pred             HHHHHHHh
Confidence            55554443


No 29 
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification]
Probab=22.30  E-value=1.3e+02  Score=30.45  Aligned_cols=20  Identities=15%  Similarity=0.142  Sum_probs=8.6

Q ss_pred             cchhHHHHHHHhhhHHHHHH
Q 018539          149 FGLNELDFVFSTLVVGSIMN  168 (354)
Q Consensus       149 ~f~~ElDfV~sdvv~gsv~n  168 (354)
                      +-|+-+-==|+.-+++-+=|
T Consensus       132 RVWnPfrSKLAA~I~gGvdn  151 (317)
T KOG1596|consen  132 RVWNPFRSKLAAGILGGVDN  151 (317)
T ss_pred             EEeChHHHHHHHHhhcCccc
Confidence            34444444444444443333


No 30 
>PRK12799 motB flagellar motor protein MotB; Reviewed
Probab=21.08  E-value=68  Score=33.61  Aligned_cols=28  Identities=18%  Similarity=0.394  Sum_probs=25.1

Q ss_pred             hHHHHHHHhhhHHHHHHHHhhhhccccc
Q 018539          152 NELDFVFSTLVVGSIMNFTLMYLLAPTL  179 (354)
Q Consensus       152 ~ElDfV~sdvv~gsv~nf~LVwlLAPt~  179 (354)
                      ..|=.-++|+|++..+=|+|+|+++=+-
T Consensus        25 gaWkVAYADfvTlLMAFFlLLwsmSsvd   52 (421)
T PRK12799         25 GSWKIAYADFMTAMMAFFLVMWLLAVSS   52 (421)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHHhhcCC
Confidence            4799999999999999999999998653


No 31 
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=20.72  E-value=1.2e+02  Score=26.60  Aligned_cols=40  Identities=33%  Similarity=0.521  Sum_probs=0.0

Q ss_pred             ceecccCCCCceeeccCCCCCCCCCCCCCCCCCCCCCCCC
Q 018539           50 SILHSKVSPPRFELSSTGGGGSYGTGHGKGGGGGGGDGSG   89 (354)
Q Consensus        50 ~~~~~~~~~~~~~~~~~g~~g~~g~~gg~~gggggg~~~g   89 (354)
                      +.++-+...++-.-...++++.++.+++++.||++|+.+|
T Consensus       104 r~l~V~~a~~~~~~~~~~~g~~~~~~~~g~~gg~~g~~~g  143 (144)
T PLN03134        104 RHIRVNPANDRPSAPRAYGGGGGYSGGGGGYGGGGDGGGG  143 (144)
T ss_pred             EEEEEEeCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC


Done!