BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018560
         (354 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QQK|A Chain A, The Crystal Structure Of Fibroblast Growth Factor 7
           (Keratinocyte Growth Factor)
 pdb|1QQK|B Chain B, The Crystal Structure Of Fibroblast Growth Factor 7
           (Keratinocyte Growth Factor)
          Length = 140

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 261 KLYGKIEVDLEENDIIDVILENNYNTYS 288
           KLY K E + E+ +  ++ILEN+YNTY+
Sbjct: 72  KLYAKKECN-EDCNFKELILENHYNTYA 98


>pdb|3F96|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Sarin
 pdb|3F96|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Sarin
          Length = 383

 Score = 28.1 bits (61), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 236 NESIPLSKQEDLIVWMRTAALPTFRKLYGKIEVDLEENDIIDVILENN----YNTYSFSG 291
           N + PL   E   + + +  L  FR LY  I +DL  +  I   +E+       TY F  
Sbjct: 87  NWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKD 146

Query: 292 KKKLVLSTTSWL 303
           +    +   SWL
Sbjct: 147 QSAAEIGDKSWL 158


>pdb|3D59|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase
 pdb|3D59|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase
 pdb|3D5E|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Paraoxon
 pdb|3D5E|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Paraoxon
 pdb|3F97|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Soman
 pdb|3F97|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Soman
 pdb|3F98|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Tabun
 pdb|3F98|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Tabun
 pdb|3F98|C Chain C, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By Tabun
 pdb|3F9C|A Chain A, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By
           Diisopropylfluorophosphate
 pdb|3F9C|B Chain B, Crystal Structure Of Human Plasma Platelet Activating
           Factor Acetylhydrolase Covalently Inhibited By
           Diisopropylfluorophosphate
          Length = 383

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 236 NESIPLSKQEDLIVWMRTAALPTFRKLYGKIEVDLEENDIIDVILENN----YNTYSFSG 291
           N + PL   E   + + +  L  FR LY  I +DL  +  I   +E+       TY F  
Sbjct: 87  NWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKD 146

Query: 292 KKKLVLSTTSWL 303
           +    +   SWL
Sbjct: 147 QSAAEIGDKSWL 158


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,348,299
Number of Sequences: 62578
Number of extensions: 440651
Number of successful extensions: 975
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 975
Number of HSP's gapped (non-prelim): 3
length of query: 354
length of database: 14,973,337
effective HSP length: 100
effective length of query: 254
effective length of database: 8,715,537
effective search space: 2213746398
effective search space used: 2213746398
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)