BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018573
(354 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1HDS|A Chain A, Macromolecular Structure Refinement By Restrained Least-
Squares And Interactive Graphics As Applied To Sickling
Deer Type Iii Hemoglobin
pdb|1HDS|C Chain C, Macromolecular Structure Refinement By Restrained Least-
Squares And Interactive Graphics As Applied To Sickling
Deer Type Iii Hemoglobin
Length = 141
Score = 30.0 bits (66), Expect = 2.2, Method: Compositional matrix adjust.
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 78 LSIPAKSTVNSAPKSVGNITPISETRAKR---LSIPQRKSETPRYDISLSSSRKK 129
LS KS V +A VG P +A + LS P K+ P +D+S S+++K
Sbjct: 2 LSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLSFPTTKTYFPHFDLSHGSAQQK 56
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.304 0.121 0.322
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,456,551
Number of Sequences: 62578
Number of extensions: 222651
Number of successful extensions: 313
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 311
Number of HSP's gapped (non-prelim): 3
length of query: 354
length of database: 14,973,337
effective HSP length: 100
effective length of query: 254
effective length of database: 8,715,537
effective search space: 2213746398
effective search space used: 2213746398
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 52 (24.6 bits)