BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018599
(353 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HQX|A Chain A, Crystal Structure Of Protein Of Unknown Function
(Duf1255,Pf06865) From Acinetobacter Sp. Adp1
Length = 111
Score = 29.6 bits (65), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 19/75 (25%)
Query: 135 FDSVGRSSKSNVLGGGLCLKNIHTSSSMCFSAGSAHDLSFDGGSRNELIGSVASEQTILG 194
FD V KSNV GGLC+ +H + F+ G++ L + +EQ +
Sbjct: 9 FDHVTVIKKSNVYFGGLCI---------------SHTVQFEDGTKKTLGVILPTEQPLTF 53
Query: 195 ERAL----KLLSGSC 205
E + +++SG C
Sbjct: 54 ETHVPERXEIISGEC 68
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.134 0.394
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,914,019
Number of Sequences: 62578
Number of extensions: 304600
Number of successful extensions: 524
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 524
Number of HSP's gapped (non-prelim): 1
length of query: 353
length of database: 14,973,337
effective HSP length: 100
effective length of query: 253
effective length of database: 8,715,537
effective search space: 2205030861
effective search space used: 2205030861
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)