Citrus Sinensis ID: 018619

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MYLVCCILQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAGT
ccEEEEEEEEEEEEEEEEEEccccEEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEcEEEccccccccEEEEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccccEEEEEEcccccHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHccccccccccc
MYLVCCILQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLG*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLVCCILQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Shaggy-related protein kinase eta Negative regulator in brassinosteroid signal transduction pathway important for plant growth. May be also involved in auxin signaling pathway. Phosphorylates and increases the degradation of BZR1 and BZR2/BES1 by the proteasome. Phosphorylates BHLH150, beet curly top virus C4 and tomato golden mosaic virus AC4 on threonine and serine residues.confidentQ39011
Shaggy-related protein kinase NtK-1 May mediate extracellular signals to regulate transcription in differentiating cells.probableQ40518
Glycogen synthase kinase-3 Phosphorylates oma-1, a regulator of the oocyte-to-embryo transition, enabling its degradation. Phosphorylates skn-1, preventing it from accumulating in nuclei and thus inhibiting phase II gene expression in the oxidative stress defense. Involved in mesendoderm specification and mitotic spindle orientation in EMS blastomeres. Thought to be a branch point in these processes as proteins downstream are not required. Negatively regulates Wnt signaling in vulval precursor cells and acts as a Wnt-independent repressor of med-1 and med-2 in the C lineage inhibiting mesoderm development. Required for normal lifespan and LiCl-induced lifespan extension.probableQ9U2Q9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E7W, chain A
Confidence level:very confident
Coverage over the Query: 8-343
View the alignment between query and template
View the model in PyMOL