BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018637
         (352 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZXQ|A Chain A, Crystal Structure Of Endo-Alpha-N-Acetylgalactosaminidase
           From Bifidobacterium Longum (Engbf)
          Length = 1376

 Score = 28.1 bits (61), Expect = 8.3,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 124 GLQQLEEATGLAFRFIIGRTNDQSKMAELRKEVAEYDDFILLDI 167
           G   L++  G+   + +   +  S+ A+L KEV +  DFI LD+
Sbjct: 429 GWNWLDQGVGIDGIYDLASGSRVSRFADLSKEVGDNMDFIYLDV 472


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,023,849
Number of Sequences: 62578
Number of extensions: 324350
Number of successful extensions: 788
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 787
Number of HSP's gapped (non-prelim): 3
length of query: 352
length of database: 14,973,337
effective HSP length: 100
effective length of query: 252
effective length of database: 8,715,537
effective search space: 2196315324
effective search space used: 2196315324
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)