Citrus Sinensis ID: 018666


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
ccHHHHHcccccEEEEccccccccEEEEEEEccccEEEEEEEEEEcccccccccccccccccCEECcccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHcccccccccccccccCEEcEEEEccccccHHHHcccccccccccccccEEEEECcEECcccc
MYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIEN*************EKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized calcium-binding protein At1g02270 probableO81916

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 207-308
View the alignment between query and template
View the model in PyMOL
Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 2-143
View the alignment between query and template
View the model in PyMOL
Template: 3MPR, chain A
Confidence level:confident
Coverage over the Query: 10-183
View the alignment between query and template
View the model in PyMOL
Template: 2L4H, chain A
Confidence level:confident
Coverage over the Query: 192-282
View the alignment between query and template
View the model in PyMOL
Template: 1IQ3, chain A
Confidence level:confident
Coverage over the Query: 251-333
View the alignment between query and template
View the model in PyMOL