BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 018692
         (352 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1S72|N Chain N, Refined Crystal Structure Of The Haloarcula Marismortui
           Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1YHQ|N Chain N, Crystal Structure Of Azithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|N Chain N, Crystal Structure Of Erythromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|N Chain N, Crystal Structure Of Telithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|N Chain N, Crystal Structure Of Virginiamycin M And S Bound To The
           50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|N Chain N, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
           Haloarcula Marismortui Containing A Three Residue
           Deletion In L22
 pdb|1YJN|N Chain N, Crystal Structure Of Clindamycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|N Chain N, Crystal Structure Of Quinupristin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ4|N Chain N, The Structure Of The Transition State Analogue "daa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ5|N Chain N, The Structure Of The Transition State Analogue "raa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ6|N Chain N, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|N Chain N, The Structure Of The Transition State Analogue "dca" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ8|N Chain N, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQ9|N Chain N, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQK|N Chain N, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
           The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|N Chain N, The Structure Of The Transition State Analogue "dcsn"
           Bound To The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1VQM|N Chain N, The Structure Of The Transition State Analogue "dan" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQN|N Chain N, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|N Chain N, The Structure Of Ccpmn Bound To The Large Ribosomal
           Subunit Haloarcula Marismortui
 pdb|1VQP|N Chain N, The Structure Of The Transition State Analogue "rap" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2OTJ|N Chain N, 13-Deoxytedanolide Bound To The Large Subunit Of
           Haloarcula Marismortui
 pdb|2OTL|N Chain N, Girodazole Bound To The Large Subunit Of Haloarcula
           Marismortui
 pdb|2QA4|N Chain N, A More Complete Structure Of The The L7L12 STALK OF THE
           Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|N Chain N, The Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution With Rrna Sequence For The 23s Rrna And
           Genome-Derived Sequences For R-Proteins
 pdb|3CC4|N Chain N, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|3CC7|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2487u
 pdb|3CCE|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535a
 pdb|3CCJ|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2534u
 pdb|3CCL|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535c. Density For Anisomycin Is
           Visible But Not Included In Model.
 pdb|3CCM|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2611u
 pdb|3CCQ|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488u
 pdb|3CCR|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488c. Density For Anisomycin Is
           Visible But Not Included In The Model.
 pdb|3CCS|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482a
 pdb|3CCU|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482c
 pdb|3CCV|N Chain N, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2616a
 pdb|3CD6|N Chain N, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
           Cc-puromycin
 pdb|3CPW|M Chain M, The Structure Of The Antibiotic Linezolid Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|N Chain N, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|N Chain N, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The Large
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|N Chain N, Negamycin Binds To The Wall Of The Nascent Chain Exit
           Tunnel Of The 50s Ribosomal Subunit
 pdb|3I55|N Chain N, Co-Crystal Structure Of Mycalamide A Bound To The Large
           Ribosomal Subunit
 pdb|3I56|N Chain N, Co-Crystal Structure Of Triacetyloleandomcyin Bound To The
           Large Ribosomal Subunit
 pdb|4ADX|N Chain N, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
           Subunit In Complex With Initiation Factor 6
          Length = 187

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 9/131 (6%)

Query: 173 NKIIRLLSEGKPRLDISEFENSGEKLFDLLIEGPSGLSVVAILDSSGFDKTAFAADTYNN 232
           ++ +RLL  GKPRL ++   N   +   L+  GP+G   +A   SS   +  + A T  N
Sbjct: 22  HQRLRLLKSGKPRL-VARKSNKHVRA-QLVTLGPNGDDTLASAHSSDLAEYGWEAPT-GN 78

Query: 233 NHVKFYFDCLAWVRVSMLHDFGKILDDIIKSVMPPARVRVI------IGEDYQLKKSILQ 286
               +    LA +R         +LD  + S  P ++V  I       G D      +L 
Sbjct: 79  MPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLA 138

Query: 287 DYLTNKKYFIV 297
           D+   +   I 
Sbjct: 139 DWQRTRGAHIA 149


>pdb|1FFK|K Chain K, Crystal Structure Of The Large Ribosomal Subunit From
           Haloarcula Marismortui At 2.4 Angstrom Resolution
 pdb|1GIY|Q Chain Q, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
 pdb|1JJ2|M Chain M, Fully Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution
 pdb|1KQS|M Chain M, The Haloarcula Marismortui 50s Complexed With A
           Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|O Chain O, Co-Crystal Structure Of Carbomycin A Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|O Chain O, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal
           Subunit Of Haloarcula Marismortui
 pdb|1KD1|O Chain O, Co-crystal Structure Of Spiramycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|O Chain O, Co-Crystal Structure Of Azithromycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|O Chain O, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
           Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1ML5|QQ Chain q, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 pdb|1K73|O Chain O, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|1KC8|O Chain O, Co-Crystal Structure Of Blasticidin S Bound To The 50s
           Ribosomal Subunit
 pdb|1N8R|O Chain O, Structure Of Large Ribosomal Subunit In Complex With
           Virginiamycin M
 pdb|1NJI|O Chain O, Structure Of Chloramphenicol Bound To The 50s Ribosomal
           Subunit
 pdb|1Q7Y|O Chain O, Crystal Structure Of Ccdap-puromycin Bound At The Peptidyl
           Transferase Center Of The 50s Ribosomal Subunit
 pdb|1Q81|O Chain O, Crystal Structure Of Minihelix With 3' Puromycin Bound To
           A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|O Chain O, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
           The 50s Ribosomal Subunit
 pdb|1Q86|O Chain O, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
           Simultaneously At Half Occupancy To Both The A-Site And
           P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|M Chain M, Structure Of A Deacylated Trna Minihelix Bound To The E
           Site Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1QVG|M Chain M, Structure Of Cca Oligonucleotide Bound To The Trna Binding
           Sites Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1W2B|M Chain M, Trigger Factor Ribosome Binding Domain In Complex With 50s
 pdb|1YL3|Q Chain Q, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 pdb|2B66|S Chain S, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 pdb|2B9N|S Chain S, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 pdb|2B9P|S Chain S, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 pdb|3CXC|M Chain M, The Structure Of An Enhanced Oxazolidinone Inhibitor Bound
           To The 50s Ribosomal Subunit Of H. Marismortui
 pdb|3G4S|N Chain N, Co-Crystal Structure Of Tiamulin Bound To The Large
           Ribosomal Subunit
 pdb|3G6E|N Chain N, Co-Crystal Structure Of Homoharringtonine Bound To The
           Large Ribosomal Subunit
 pdb|3G71|N Chain N, Co-crystal Structure Of Bruceantin Bound To The Large
           Ribosomal Subunit
 pdb|3OW2|M Chain M, Crystal Structure Of Enhanced Macrolide Bound To 50s
           Ribosomal Subunit
          Length = 186

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 9/131 (6%)

Query: 173 NKIIRLLSEGKPRLDISEFENSGEKLFDLLIEGPSGLSVVAILDSSGFDKTAFAADTYNN 232
           ++ +RLL  GKPRL ++   N   +   L+  GP+G   +A   SS   +  + A T  N
Sbjct: 21  HQRLRLLKSGKPRL-VARKSNKHVRA-QLVTLGPNGDDTLASAHSSDLAEYGWEAPT-GN 77

Query: 233 NHVKFYFDCLAWVRVSMLHDFGKILDDIIKSVMPPARVRVI------IGEDYQLKKSILQ 286
               +    LA +R         +LD  + S  P ++V  I       G D      +L 
Sbjct: 78  MPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLA 137

Query: 287 DYLTNKKYFIV 297
           D+   +   I 
Sbjct: 138 DWQRTRGAHIA 148


>pdb|2GTQ|A Chain A, Crystal Structure Of Aminopeptidase N From Human Pathogen
           Neisseria Meningitidis
          Length = 867

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 282 KSILQDYLTNKKYFIVLDDVFDESEIWDDLEEVLPENQNGSRVLILSKVALHVETPKY 339
           + ++ D L +  +  +L  V  E+E+WD  E + P   + +R  +L  +A+H   PK+
Sbjct: 595 EKVISDDLLDNAFKALLLGVPSEAELWDGAENIDPLRYHQAREALLDTLAVHF-LPKW 651


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.140    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,118,982
Number of Sequences: 62578
Number of extensions: 350715
Number of successful extensions: 763
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 762
Number of HSP's gapped (non-prelim): 6
length of query: 352
length of database: 14,973,337
effective HSP length: 100
effective length of query: 252
effective length of database: 8,715,537
effective search space: 2196315324
effective search space used: 2196315324
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)