Citrus Sinensis ID: 018703


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSESAASSSSSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRFTNLSQLTVTLV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEECccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccHHHHHHHHcc
*SKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHV*************************ITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSS*TSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGR*************GSTVIAKDIRFTNLSQLTVTLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSESAASSSSSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRFTNLSQLTVTLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 69 confidentE0X9N4
E3 ubiquitin-protein ligase makorin E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.probableQ5ZA07
E3 ubiquitin-protein ligase makorin E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.probableQ6IDS6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y43, chain A
Confidence level:confident
Coverage over the Query: 192-237,249-285
View the alignment between query and template
View the model in PyMOL
Template: 2D9N, chain A
Confidence level:confident
Coverage over the Query: 3-59
View the alignment between query and template
View the model in PyMOL
Template: 2FC6, chain A
Confidence level:probable
Coverage over the Query: 129-157
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 185-239,251-287
View the alignment between query and template
View the model in PyMOL