Citrus Sinensis ID: 018736


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MAALITAQNCFVPRPKEEEEEIERIYKGYRDKMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWLKAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILATHIAYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRPKDLPELSSEEAFDLFCHGVTPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEENGIVQEIVKLCSFENMSNLEVNRNGKSRVRAEVKNDVFFRQGKVGDWKNHLTDEMIERLDQITKHKFDGTGLIVDTWIDHHTSDY
cccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEccCECccccccHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEEccccccEEEHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEEEccHHcccHHHHHHHHHHHccccccHHHHHcHHHHHHHHHccHHHcccccccccccccccccccccccECccccccccccccHHHHHHHHHHHHHHccccccEEEEEcccccccc
*********************IERIYKGYRDKMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWLKAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILATHIAYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRPKDLPELSSEEAFDLFCHGVTPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEENGIVQEIVKLCSFENMSNLEVNRN**SRVRAEVKNDVFFRQGKVGDWKNHLTDEMIERLDQITKHKFDGTGLIVDTWIDHH****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAALITAQNCFVPRPKEEEEEIERIYKGYRDKMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWLKAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILATHIAYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRPKDLPELSSEEAFDLFCHGVTPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEENGIVQEIVKLCSFENMSNLEVNRNGKSRVRAEVKNDVFFRQGKVGDWKNHLTDEMIERLDQITKHKFDGTGLIVDTWIDHHTSDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytosolic sulfotransferase 16 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of desulfo-glucosinolates (dsGSs), the final step in the biosynthesis of the glucosinolate core structure. Substrate preference is desulfo-2-phenylethyl glucosinolate > desulfo-indol-3-yl methyl glucosinolate > desulfo-benzyl glucosinolate > desulfo-6-methylthiohexyl glucosinolate > desulfo-4-methylthiobutyl glucosinolate > desulfo-3-methylthiopropyl glucosinolate > desulfo-singrin > desulfo-3-butenyl glucosinolate.probableQ9C9D0
Sulfotransferase family cytosolic 1B member 1 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates thyroid hormones including 3,3'-diiodothyronine, catechols such as 4-nitrocatechol and 4-isopropylcatechol and phenols such as 2-bromophenol.probableQ8JG30

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q44, chain A
Confidence level:very confident
Coverage over the Query: 24-280,312-341
View the alignment between query and template
View the model in PyMOL