Citrus Sinensis ID: 018747


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MPPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVRLDNAVASKPSA
ccccHHHHHHHHccccccccccccHHHHHHHHHcccccccccccccccccEEEEEEcccccHHHHHHHHHcccEEEEEccccccHHHHHHccccccccHHHHHccccEEEEcccccccccHHHcccccccccccccccEEEEcccccHHHHHHHHHHHHHcccccEEccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHccccHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccc
ccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccHHHHHHcccEEEEEEcccccHHEEEEccccccHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEcccccccccccccEEEEEEcccHHHHHHHHHHHHHHcHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccEccccccccccc
MPPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSmatvastdpvcptntrigwigtGVMGRSMCAHLLNAGYTVTVFNrtlskaqplldigahladsphslasqsdVVFSIvgypsdvrhvllhpssgalsglrpggiivdmttsepslASELSAAAsskncsaidapvsggdrgaktgtlaifaggdesvVQKLNPLFALMGKvnymggsgkgqFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTgaagsksldlhgsrilkrdfepgffvNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKahgegnlgTQALILALERLNnvrldnavaskpsa
MPPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMAtvastdpvcptntRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNvrldnavaskpsa
MppllplllvlRSRTAHSYslsvsslvtlllrrrsMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTsepslaselsaaassKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMglalpglalaqqlylSLKAHGEGNLGTQALILALERLNNVRLDNAVASKPSA
****LPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIV*************************************TGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVRL**********
**PLLP*********************************************IGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALER****************
MPPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEP*************NCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVRLDNAVASKPSA
*PPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVRLD*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPLLPLLLVLRSRTAHSYSLSVSSLVTLLLRRRSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVRLDNAVASKPSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
Q9SZE1334 Probable 3-hydroxyisobuty yes no 0.911 0.958 0.766 1e-146
O34948288 Uncharacterized oxidoredu yes no 0.789 0.961 0.491 7e-73
Q949M8318 Probable 3-hydroxyisobuty no no 0.820 0.905 0.484 7e-67
Q9C991299 Probable 3-hydroxyisobuty no no 0.826 0.969 0.477 4e-66
O33730291 Uncharacterized oxidoredu yes no 0.809 0.975 0.365 2e-43
P0ABQ2294 2-hydroxy-3-oxopropionate N/A no 0.826 0.986 0.342 2e-43
P0ABQ3294 2-hydroxy-3-oxopropionate yes no 0.826 0.986 0.342 2e-43
P77161292 2-hydroxy-3-oxopropionate N/A no 0.820 0.986 0.358 1e-42
Q5RKN4462 Putative oxidoreductase G yes no 0.777 0.590 0.329 5e-38
Q562D5534 Putative oxidoreductase G yes no 0.777 0.511 0.323 7e-37
>sp|Q9SZE1|3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana GN=At4g29120 PE=2 SV=1 Back     alignment and function desciption
 Score =  517 bits (1331), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 246/321 (76%), Positives = 289/321 (90%), Gaps = 1/321 (0%)

Query: 25  SLVTLLLRRRSMAT-VASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLS 83
           S+V+    RRSMA+   S+D + P+NT+IGWIGTGVMGRSMC HL+ AGYTVTVFNRT+S
Sbjct: 12  SVVSSFFLRRSMASSTISSDIITPSNTKIGWIGTGVMGRSMCGHLIKAGYTVTVFNRTIS 71

Query: 84  KAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDM 143
           KAQ L+D+GA++ADSP+S+A QSDVVF+IVGYPSDVRHVLL P SGALSGLR GG++VDM
Sbjct: 72  KAQTLIDMGANVADSPNSVAEQSDVVFTIVGYPSDVRHVLLDPKSGALSGLRQGGVLVDM 131

Query: 144 TTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALM 203
           TTSEPSLA E++ AAS KNC +IDAPVSGGD GAK G L+IFAGGDE+ V++L+PLF+LM
Sbjct: 132 TTSEPSLAEEIAKAASFKNCFSIDAPVSGGDLGAKNGKLSIFAGGDETTVKRLDPLFSLM 191

Query: 204 GKVNYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKS 263
           GKVN+MG SGKGQFAKLANQITIA+TM+GLVEG++YAHKAGL+V+ FL AISTGAAGSKS
Sbjct: 192 GKVNFMGTSGKGQFAKLANQITIASTMLGLVEGLIYAHKAGLDVKKFLEAISTGAAGSKS 251

Query: 264 LDLHGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGN 323
           +DL+G RILKRDF+PGF+VNHFVKDLGICL ECQ MGLALPGLALAQQLYLSLKAHGEG+
Sbjct: 252 IDLYGDRILKRDFDPGFYVNHFVKDLGICLNECQRMGLALPGLALAQQLYLSLKAHGEGD 311

Query: 324 LGTQALILALERLNNVRLDNA 344
           LGTQAL+LALERLNNV + ++
Sbjct: 312 LGTQALLLALERLNNVSVQSS 332





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 1
>sp|O34948|YKWC_BACSU Uncharacterized oxidoreductase YkwC OS=Bacillus subtilis (strain 168) GN=ykwC PE=3 SV=1 Back     alignment and function description
>sp|Q949M8|3HID3_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial OS=Arabidopsis thaliana GN=At1g71180 PE=2 SV=1 Back     alignment and function description
>sp|Q9C991|3HID2_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial OS=Arabidopsis thaliana GN=At1g71170 PE=2 SV=1 Back     alignment and function description
>sp|O33730|Y1503_SHEFN Uncharacterized oxidoreductase Sfri_1503 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_1503 PE=3 SV=2 Back     alignment and function description
>sp|P0ABQ2|GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=garR PE=1 SV=1 Back     alignment and function description
>sp|P0ABQ3|GARR_ECOL6 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=garR PE=3 SV=1 Back     alignment and function description
>sp|P77161|GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=glxR PE=2 SV=1 Back     alignment and function description
>sp|Q5RKN4|GLYR1_DANRE Putative oxidoreductase GLYR1 OS=Danio rerio GN=glyr1 PE=2 SV=1 Back     alignment and function description
>sp|Q562D5|GLYR1_XENTR Putative oxidoreductase GLYR1 OS=Xenopus tropicalis GN=glyr1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
224142211315 predicted protein [Populus trichocarpa] 0.891 0.993 0.806 1e-148
449446526310 PREDICTED: uncharacterized oxidoreductas 0.874 0.990 0.811 1e-145
15233455334 3-hydroxyisobutyrate dehydrogenase [Arab 0.911 0.958 0.766 1e-144
297803134334 6-phosphogluconate dehydrogenase NAD-bin 0.928 0.976 0.757 1e-143
359484336348 PREDICTED: uncharacterized oxidoreductas 0.894 0.902 0.802 1e-142
357520839343 Oxidoreductase, putative [Medicago trunc 0.888 0.909 0.785 1e-142
356513175310 PREDICTED: uncharacterized oxidoreductas 0.863 0.977 0.799 1e-142
356523828309 PREDICTED: uncharacterized oxidoreductas 0.863 0.980 0.796 1e-139
449487965314 PREDICTED: uncharacterized oxidoreductas 0.866 0.968 0.743 1e-129
449446524314 PREDICTED: uncharacterized oxidoreductas 0.866 0.968 0.743 1e-129
>gi|224142211|ref|XP_002324452.1| predicted protein [Populus trichocarpa] gi|222865886|gb|EEF03017.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  532 bits (1370), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/315 (80%), Positives = 290/315 (92%), Gaps = 2/315 (0%)

Query: 31  LRRRSMATVAST--DPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPL 88
           L  R+MA  A+T  +P+ P+NTR+GWIGTGVMGRSMC HL+ AGY VTVFNRTLSKAQPL
Sbjct: 1   LLHRTMAAAATTNVEPISPSNTRVGWIGTGVMGRSMCGHLIKAGYKVTVFNRTLSKAQPL 60

Query: 89  LDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEP 148
           +D+GA LA SP ++ASQSDVVFSIVG+PSDVR VLL  +SGAL GLRPGG++VDMTTSEP
Sbjct: 61  IDMGARLAQSPLAVASQSDVVFSIVGFPSDVRSVLLDSTSGALPGLRPGGVLVDMTTSEP 120

Query: 149 SLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNY 208
           SLA+E+SAAA+ K+C ++DAPVSGGDRGAK G+LAIFAGGD++V+ +L+PLFALMG+VNY
Sbjct: 121 SLAAEISAAATIKDCHSVDAPVSGGDRGAKNGSLAIFAGGDKTVIDRLSPLFALMGRVNY 180

Query: 209 MGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHG 268
           MG +GKGQFAKLANQITIA+TMVGLVEG++YAHKAGLNVE +LNAISTGAAGSKSLDL+G
Sbjct: 181 MGATGKGQFAKLANQITIASTMVGLVEGIIYAHKAGLNVESYLNAISTGAAGSKSLDLYG 240

Query: 269 SRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQA 328
           SRILKRDFE GF+VNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQA
Sbjct: 241 SRILKRDFEAGFYVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQA 300

Query: 329 LILALERLNNVRLDN 343
           LILALERLNNV L+N
Sbjct: 301 LILALERLNNVSLEN 315




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449446526|ref|XP_004141022.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] gi|449487969|ref|XP_004157891.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15233455|ref|NP_194641.1| 3-hydroxyisobutyrate dehydrogenase [Arabidopsis thaliana] gi|75266757|sp|Q9SZE1.1|3HID1_ARATH RecName: Full=Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial; Short=HIBADH-like; Flags: Precursor gi|13877869|gb|AAK44012.1|AF370197_1 unknown protein [Arabidopsis thaliana] gi|4972058|emb|CAB43926.1| putative protein [Arabidopsis thaliana] gi|7269810|emb|CAB79670.1| putative protein [Arabidopsis thaliana] gi|17065608|gb|AAL33784.1| unknown protein [Arabidopsis thaliana] gi|332660189|gb|AEE85589.1| 3-hydroxyisobutyrate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297803134|ref|XP_002869451.1| 6-phosphogluconate dehydrogenase NAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315287|gb|EFH45710.1| 6-phosphogluconate dehydrogenase NAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359484336|ref|XP_002283629.2| PREDICTED: uncharacterized oxidoreductase ykwC-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357520839|ref|XP_003630708.1| Oxidoreductase, putative [Medicago truncatula] gi|355524730|gb|AET05184.1| Oxidoreductase, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|356513175|ref|XP_003525289.1| PREDICTED: uncharacterized oxidoreductase ykwC-like [Glycine max] Back     alignment and taxonomy information
>gi|356523828|ref|XP_003530536.1| PREDICTED: uncharacterized oxidoreductase ykwC-like [Glycine max] Back     alignment and taxonomy information
>gi|449487965|ref|XP_004157889.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449446524|ref|XP_004141021.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
TAIR|locus:2119921334 AT4G29120 [Arabidopsis thalian 0.877 0.922 0.694 7.3e-114
TAIR|locus:2026351318 AT1G71180 [Arabidopsis thalian 0.814 0.899 0.450 4.8e-62
TAIR|locus:2026341299 AT1G71170 [Arabidopsis thalian 0.820 0.963 0.436 3.9e-60
UNIPROTKB|Q9KNF7315 VC_A0007 "3-hydroxyisobutyrate 0.806 0.898 0.356 6.4e-44
TIGR_CMR|VC_A0007315 VC_A0007 "2-hydroxy-3-oxopropi 0.806 0.898 0.356 6.4e-44
TIGR_CMR|CPS_2007287 CPS_2007 "3-hydroxyisobutyrate 0.794 0.972 0.361 2.2e-41
TIGR_CMR|SO_2771291 SO_2771 "2-hydroxy-3-oxopropio 0.809 0.975 0.337 5.3e-40
UNIPROTKB|Q5LVB0290 SPO0792 "6-phosphogluconate de 0.814 0.986 0.332 1.3e-38
TIGR_CMR|SPO_0792290 SPO_0792 "6-phosphogluconate d 0.814 0.986 0.332 1.3e-38
UNIPROTKB|P77161292 glxR [Escherichia coli K-12 (t 0.820 0.986 0.334 2.1e-38
TAIR|locus:2119921 AT4G29120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1123 (400.4 bits), Expect = 7.3e-114, P = 7.3e-114
 Identities = 214/308 (69%), Positives = 254/308 (82%)

Query:    37 ATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLA 96
             ++  S+D + P+NT+IGWIGTGVMGRSMC HL+ AGYTVTVFNRT+SKAQ L+D+GA++A
Sbjct:    25 SSTISSDIITPSNTKIGWIGTGVMGRSMCGHLIKAGYTVTVFNRTISKAQTLIDMGANVA 84

Query:    97 DSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTXXXXXXXXXXX 156
             DSP+S+A QSDVVF+IVGYPSDVRHVLL P SGALSGLR GG++VDMTT           
Sbjct:    85 DSPNSVAEQSDVVFTIVGYPSDVRHVLLDPKSGALSGLRQGGVLVDMTTSEPSLAEEIAK 144

Query:   157 XXXXKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSGKGQ 216
                 KNC +IDAPVSGGD GAK G L+IFAGGDE+ V++L+PLF+LMGKVN+MG SGKGQ
Sbjct:   145 AASFKNCFSIDAPVSGGDLGAKNGKLSIFAGGDETTVKRLDPLFSLMGKVNFMGTSGKGQ 204

Query:   217 FAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDF 276
             FAKLANQITIA+TM+GLVEG++YAHKAGL+V+ FL AISTGAAGSKS+DL+G RILKRDF
Sbjct:   205 FAKLANQITIASTMLGLVEGLIYAHKAGLDVKKFLEAISTGAAGSKSIDLYGDRILKRDF 264

Query:   277 EPGFFVNHFVKDLGICLKECQNMXXXXXXXXXXXXXXXSLKAHGEGNLGTQALILALERL 336
             +PGF+VNHFVKDLGICL ECQ M               SLKAHGEG+LGTQAL+LALERL
Sbjct:   265 DPGFYVNHFVKDLGICLNECQRMGLALPGLALAQQLYLSLKAHGEGDLGTQALLLALERL 324

Query:   337 NNVRLDNA 344
             NNV + ++
Sbjct:   325 NNVSVQSS 332




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=ISS
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2026351 AT1G71180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026341 AT1G71170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNF7 VC_A0007 "3-hydroxyisobutyrate dehydrogenase, putative" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0007 VC_A0007 "2-hydroxy-3-oxopropionate reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2007 CPS_2007 "3-hydroxyisobutyrate dehydrogenase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2771 SO_2771 "2-hydroxy-3-oxopropionate reductase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LVB0 SPO0792 "6-phosphogluconate dehydrogenase domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0792 SPO_0792 "6-phosphogluconate dehydrogenase domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P77161 glxR [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0ABQ3GARR_ECOL61, ., 1, ., 1, ., 6, 00.34240.82620.9863yesno
Q9SZE13HID1_ARATH1, ., 1, ., 1, ., 3, 10.76630.91160.9580yesno
O33730Y1503_SHEFN1, ., 1, ., -, ., -0.36580.80910.9759yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 1e-102
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 2e-69
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 2e-69
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 1e-59
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 2e-51
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 2e-39
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 1e-37
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 7e-28
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 6e-26
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 1e-12
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 2e-12
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 2e-11
TIGR00873 467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase ( 3e-10
pfam01488133 pfam01488, Shikimate_DH, Shikimate / quinate 5-deh 2e-08
COG0362 473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 2e-07
COG0373414 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m 3e-07
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 5e-07
PRK07680273 PRK07680, PRK07680, late competence protein ComER; 1e-06
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi 2e-06
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 4e-06
PRK00045423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 2e-05
PLN02350 493 PLN02350, PLN02350, phosphogluconate dehydrogenase 3e-05
PTZ00142 470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 5e-05
PRK11880267 PRK11880, PRK11880, pyrroline-5-carboxylate reduct 6e-05
pfam0380793 pfam03807, F420_oxidored, NADP oxidoreductase coen 3e-04
COG0345266 COG0345, ProC, Pyrroline-5-carboxylate reductase [ 8e-04
TIGR00507270 TIGR00507, aroE, shikimate 5-dehydrogenase 0.001
pfam05368232 pfam05368, NmrA, NmrA-like family 0.001
COG0169283 COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac 0.001
cd01065155 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom 0.002
PRK08655 437 PRK08655, PRK08655, prephenate dehydrogenase; Prov 0.002
PLN00203519 PLN00203, PLN00203, glutamyl-tRNA reductase 0.003
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
 Score =  302 bits (775), Expect = e-102
 Identities = 129/287 (44%), Positives = 174/287 (60%), Gaps = 3/287 (1%)

Query: 50  TRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLL-DIGAHLADSPHSLASQSDV 108
            +I +IG G+MG  M A+LL AG+ VTV+NRT  KA  LL   GA +A SP   A+++DV
Sbjct: 1   MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADV 60

Query: 109 VFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDA 168
           V +++   + VR VL    +G L GL+PG I++DM+T  P  A EL+AA ++K    +DA
Sbjct: 61  VITMLPDDAAVRAVLF-GENGLLEGLKPGAIVIDMSTISPETARELAAALAAKGLEFLDA 119

Query: 169 PVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGK-VNYMGGSGKGQFAKLANQITIA 227
           PVSGG  GA  GTL I  GGD    ++  P+   MGK + ++G  G GQ AKLAN I +A
Sbjct: 120 PVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVHVGPVGAGQAAKLANNILLA 179

Query: 228 TTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVK 287
             +  L E +  A KAGL+ ++ L  IS GAAGS  L+ +G R+L+ DF PGF V+  +K
Sbjct: 180 GNIAALAEALALAEKAGLDPDVVLEVISGGAAGSWILENYGPRMLEGDFSPGFAVDLMLK 239

Query: 288 DLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALE 334
           DLG+ L   + +G  LP  ALA +LY    A G G     ALI  LE
Sbjct: 240 DLGLALDAAKELGAPLPLTALAAELYAKAAAAGGGEEDFSALIKLLE 286


Length = 286

>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237008 PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>gnl|CDD|223422 COG0345, ProC, Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
>gnl|CDD|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>gnl|CDD|236326 PRK08655, PRK08655, prephenate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215101 PLN00203, PLN00203, glutamyl-tRNA reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
KOG0409327 consensus Predicted dehydrogenase [General functio 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 100.0
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 100.0
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 99.97
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.97
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.97
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.96
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.96
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.95
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.94
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.93
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.93
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.93
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.93
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.92
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.92
PLN02688266 pyrroline-5-carboxylate reductase 99.91
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.91
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.9
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.9
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.89
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.88
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.88
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.87
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.86
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.86
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.86
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.86
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.85
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.85
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.85
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.85
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.84
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.83
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.83
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.82
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.82
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.82
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.82
PRK07680273 late competence protein ComER; Validated 99.81
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.79
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.79
PRK08507275 prephenate dehydrogenase; Validated 99.78
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.77
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.75
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.75
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.74
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.73
PRK08655 437 prephenate dehydrogenase; Provisional 99.73
PRK07417279 arogenate dehydrogenase; Reviewed 99.73
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.73
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.72
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.71
PRK06545359 prephenate dehydrogenase; Validated 99.69
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.67
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.66
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.66
PLN02256304 arogenate dehydrogenase 99.65
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.65
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.65
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.64
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.63
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.63
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.63
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.62
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.61
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.61
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.57
PRK05479330 ketol-acid reductoisomerase; Provisional 99.56
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.56
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.55
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 99.53
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.53
PLN02712667 arogenate dehydrogenase 99.52
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.5
PLN02712 667 arogenate dehydrogenase 99.48
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.44
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.43
PRK08818370 prephenate dehydrogenase; Provisional 99.42
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.39
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.38
PRK11730715 fadB multifunctional fatty acid oxidation complex 99.33
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 99.32
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.31
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 99.29
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.28
PRK11154708 fadJ multifunctional fatty acid oxidation complex 99.26
PRK07574385 formate dehydrogenase; Provisional 99.26
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 99.25
PLN03139386 formate dehydrogenase; Provisional 99.24
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.22
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.17
PRK13403335 ketol-acid reductoisomerase; Provisional 99.17
PRK12480330 D-lactate dehydrogenase; Provisional 99.16
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 99.14
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.14
PRK13243333 glyoxylate reductase; Reviewed 99.13
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.12
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 99.11
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 99.1
PRK06436303 glycerate dehydrogenase; Provisional 99.08
PRK08605332 D-lactate dehydrogenase; Validated 99.07
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.06
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.05
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 99.02
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.02
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.98
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.97
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.97
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.96
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.95
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.95
PLN02928347 oxidoreductase family protein 98.94
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.9
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.9
PRK06141314 ornithine cyclodeaminase; Validated 98.89
PRK06444197 prephenate dehydrogenase; Provisional 98.88
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.88
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.88
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.87
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.85
PRK12549284 shikimate 5-dehydrogenase; Reviewed 98.85
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.82
PRK06487317 glycerate dehydrogenase; Provisional 98.81
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.79
PRK06932314 glycerate dehydrogenase; Provisional 98.76
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 98.74
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 98.72
PLN02306386 hydroxypyruvate reductase 98.71
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.68
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.64
PRK05225 487 ketol-acid reductoisomerase; Validated 98.63
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.63
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.59
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 98.59
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 98.59
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.54
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.5
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.49
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 98.48
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.47
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 98.47
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 98.45
PRK00048257 dihydrodipicolinate reductase; Provisional 98.44
PRK14027283 quinate/shikimate dehydrogenase; Provisional 98.43
PRK08618325 ornithine cyclodeaminase; Validated 98.42
PRK08291330 ectoine utilization protein EutC; Validated 98.42
PRK07340304 ornithine cyclodeaminase; Validated 98.41
PRK06823315 ornithine cyclodeaminase; Validated 98.4
PRK06223307 malate dehydrogenase; Reviewed 98.39
PRK12550272 shikimate 5-dehydrogenase; Reviewed 98.38
PRK13303265 L-aspartate dehydrogenase; Provisional 98.38
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 98.37
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.37
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.35
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 98.34
PTZ00075476 Adenosylhomocysteinase; Provisional 98.33
TIGR00036266 dapB dihydrodipicolinate reductase. 98.31
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.31
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.3
PRK06046326 alanine dehydrogenase; Validated 98.3
PRK06407301 ornithine cyclodeaminase; Provisional 98.3
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.3
PRK07589346 ornithine cyclodeaminase; Validated 98.26
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.25
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.24
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 98.23
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 98.22
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.21
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.18
PRK06199379 ornithine cyclodeaminase; Validated 98.17
COG0673342 MviM Predicted dehydrogenases and related proteins 98.15
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 98.14
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.14
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 98.13
PLN00203519 glutamyl-tRNA reductase 98.13
PLN02494477 adenosylhomocysteinase 98.12
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.11
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 98.1
PTZ00117319 malate dehydrogenase; Provisional 98.09
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 98.04
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.04
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.03
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.02
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 98.01
PRK11579346 putative oxidoreductase; Provisional 98.01
COG5495289 Uncharacterized conserved protein [Function unknow 98.0
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.99
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.98
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.96
PRK04148134 hypothetical protein; Provisional 97.95
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.95
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.93
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.93
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.93
PTZ00082321 L-lactate dehydrogenase; Provisional 97.9
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.9
PRK13940414 glutamyl-tRNA reductase; Provisional 97.88
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 97.87
COG2910211 Putative NADH-flavin reductase [General function p 97.87
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.86
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.84
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.82
PRK10206344 putative oxidoreductase; Provisional 97.8
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.79
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.78
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.77
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.77
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.76
PRK06349 426 homoserine dehydrogenase; Provisional 97.75
PRK08300302 acetaldehyde dehydrogenase; Validated 97.74
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.74
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.74
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 97.72
PRK09496 453 trkA potassium transporter peripheral membrane com 97.7
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.68
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.67
PRK05442326 malate dehydrogenase; Provisional 97.65
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.65
PLN02602350 lactate dehydrogenase 97.63
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 97.62
PRK10669558 putative cation:proton antiport protein; Provision 97.61
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.61
PF10100429 DUF2338: Uncharacterized protein conserved in bact 97.6
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.58
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.58
PRK03659601 glutathione-regulated potassium-efflux system prot 97.58
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.55
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.55
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.54
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.54
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.51
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.5
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.5
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.5
PF00393 291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 97.49
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.49
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.48
PRK06270341 homoserine dehydrogenase; Provisional 97.45
PRK15076 431 alpha-galactosidase; Provisional 97.45
PLN00112444 malate dehydrogenase (NADP); Provisional 97.44
PRK05086312 malate dehydrogenase; Provisional 97.43
PRK06719157 precorrin-2 dehydrogenase; Validated 97.42
PTZ00325321 malate dehydrogenase; Provisional 97.39
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 97.38
PRK08374336 homoserine dehydrogenase; Provisional 97.37
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.36
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.35
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.33
PRK03562621 glutathione-regulated potassium-efflux system prot 97.33
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.29
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.29
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.27
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.27
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.26
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.25
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.24
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.24
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 97.23
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 97.22
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.21
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.18
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.18
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.17
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.17
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.17
PLN00106323 malate dehydrogenase 97.16
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.16
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.14
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.14
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.14
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.14
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.14
PRK09496453 trkA potassium transporter peripheral membrane com 97.08
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 97.08
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.07
PRK06392326 homoserine dehydrogenase; Provisional 97.05
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.03
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.01
PRK00676338 hemA glutamyl-tRNA reductase; Validated 97.01
PLN02383344 aspartate semialdehyde dehydrogenase 96.99
PRK14982340 acyl-ACP reductase; Provisional 96.98
CHL00194317 ycf39 Ycf39; Provisional 96.98
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.98
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.97
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.95
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 96.92
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.91
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.9
COG2344211 AT-rich DNA-binding protein [General function pred 96.9
COG4408431 Uncharacterized protein conserved in bacteria [Fun 96.89
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 96.88
PLN02477410 glutamate dehydrogenase 96.88
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.88
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.85
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.79
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.78
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 96.77
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.77
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 96.75
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.71
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.71
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.71
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.7
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.7
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.69
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.68
PRK09414445 glutamate dehydrogenase; Provisional 96.67
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.64
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.64
PRK06153393 hypothetical protein; Provisional 96.63
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.62
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.55
PRK08328231 hypothetical protein; Provisional 96.53
PLN02775286 Probable dihydrodipicolinate reductase 96.51
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.51
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 96.51
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.49
PRK08040336 putative semialdehyde dehydrogenase; Provisional 96.49
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.45
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.43
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 96.43
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.42
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.41
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 96.41
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 96.41
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.37
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.37
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.36
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.34
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.34
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 96.33
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.32
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 96.31
KOG3007333 consensus Mu-crystallin [Amino acid transport and 96.3
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.28
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 96.27
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 96.27
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.26
PRK08223287 hypothetical protein; Validated 96.25
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.24
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.24
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.23
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.22
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 96.22
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.21
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 96.21
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.2
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.2
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.2
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.19
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.18
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.17
PRK10537393 voltage-gated potassium channel; Provisional 96.17
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.17
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.16
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.14
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.14
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.13
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.12
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.11
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 96.1
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.07
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.07
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.05
PRK11908347 NAD-dependent epimerase/dehydratase family protein 96.04
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.03
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 96.02
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.01
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 95.99
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.98
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 95.98
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.96
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 95.96
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.96
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.96
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 95.94
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 95.94
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.92
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.92
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.92
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 95.9
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.9
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 95.89
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 95.89
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.85
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.83
PLN02695370 GDP-D-mannose-3',5'-epimerase 95.83
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 95.81
PRK06813346 homoserine dehydrogenase; Validated 95.8
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 95.79
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 95.74
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 95.72
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 95.71
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.7
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.68
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.66
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.63
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.63
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.62
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 95.61
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.6
PRK14852 989 hypothetical protein; Provisional 95.58
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 95.57
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.55
PRK12814 652 putative NADPH-dependent glutamate synthase small 95.53
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 95.52
PRK09287459 6-phosphogluconate dehydrogenase; Validated 95.51
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 95.5
PRK07411390 hypothetical protein; Validated 95.49
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.47
PRK14030445 glutamate dehydrogenase; Provisional 95.46
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 95.43
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.43
PRK14851 679 hypothetical protein; Provisional 95.41
PRK05868372 hypothetical protein; Validated 95.4
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.36
COG0300265 DltE Short-chain dehydrogenases of various substra 95.33
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.33
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.31
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.26
PLN00016378 RNA-binding protein; Provisional 95.26
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 95.24
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.21
PRK10538248 malonic semialdehyde reductase; Provisional 95.2
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 95.18
PRK05993277 short chain dehydrogenase; Provisional 95.18
PLN02427386 UDP-apiose/xylose synthase 95.13
PRK06753373 hypothetical protein; Provisional 95.12
PRK05884223 short chain dehydrogenase; Provisional 95.09
PRK07454241 short chain dehydrogenase; Provisional 95.06
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 95.05
PLN03209 576 translocon at the inner envelope of chloroplast su 95.04
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 95.03
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 95.01
PRK06182273 short chain dehydrogenase; Validated 95.0
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 95.0
PLN02896353 cinnamyl-alcohol dehydrogenase 94.99
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 94.98
PRK08017256 oxidoreductase; Provisional 94.97
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 94.97
PRK08163396 salicylate hydroxylase; Provisional 94.96
PRK05693274 short chain dehydrogenase; Provisional 94.96
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 94.95
PRK14031444 glutamate dehydrogenase; Provisional 94.95
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 94.95
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 94.94
PRK07236386 hypothetical protein; Provisional 94.92
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 94.89
KOG03992142 consensus Glutamate synthase [Amino acid transport 94.85
PRK06180277 short chain dehydrogenase; Provisional 94.83
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 94.83
PRK05569141 flavodoxin; Provisional 94.82
PRK07024257 short chain dehydrogenase; Provisional 94.78
PRK12779 944 putative bifunctional glutamate synthase subunit b 94.75
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 94.73
PRK08177225 short chain dehydrogenase; Provisional 94.72
PRK06847375 hypothetical protein; Provisional 94.7
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.69
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 94.67
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 94.67
PRK12771564 putative glutamate synthase (NADPH) small subunit; 94.66
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 94.64
PRK07045388 putative monooxygenase; Reviewed 94.62
PRK12939250 short chain dehydrogenase; Provisional 94.62
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.62
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.61
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.6
PLN02214342 cinnamoyl-CoA reductase 94.6
PRK05866293 short chain dehydrogenase; Provisional 94.6
COG0773 459 MurC UDP-N-acetylmuramate-alanine ligase [Cell env 94.59
PRK05876275 short chain dehydrogenase; Provisional 94.57
KOG1495332 consensus Lactate dehydrogenase [Energy production 94.54
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.51
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 94.48
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 94.48
PRK07538 413 hypothetical protein; Provisional 94.46
PLN02650351 dihydroflavonol-4-reductase 94.45
PRK07825273 short chain dehydrogenase; Provisional 94.45
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 94.43
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 94.42
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.4
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 94.39
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 94.37
PRK07060245 short chain dehydrogenase; Provisional 94.36
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 94.35
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 94.34
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.8e-51  Score=367.04  Aligned_cols=284  Identities=45%  Similarity=0.694  Sum_probs=274.9

Q ss_pred             CeEEEEccChhhHHHHHHHHHCCCeEEEEeCCccc-chhHHhcCCcccCCHHHhhcCCCEEEEecCChhHHHHHhhCCCC
Q 018747           50 TRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSK-AQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSS  128 (351)
Q Consensus        50 ~kI~iIG~G~mG~~ia~~L~~~g~~V~~~dr~~~~-~~~~~~~g~~~~~~~~~~~~~~DiIi~~vp~~~~~~~v~~~~~~  128 (351)
                      +||+|||+|.||..||.+|.++||+|++|||++++ .+.+.+.|.....++.|++..+|+||+|+|++.++++++.++. 
T Consensus         1 ~kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a~s~~eaa~~aDvVitmv~~~~~V~~V~~g~~-   79 (286)
T COG2084           1 MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADVVITMLPDDAAVRAVLFGEN-   79 (286)
T ss_pred             CeEEEEcCchhhHHHHHHHHHCCCEEEEEeCChhhhhHHHHHcCCcccCCHHHHHHhCCEEEEecCCHHHHHHHHhCcc-
Confidence            58999999999999999999999999999999999 6666677999999999999999999999999999999998766 


Q ss_pred             CcccCCCCCcEEEecCCCChhHHHHHHHHHhcCCCcEEeccCCCCchhhccCceeEEecCCHHHHHHHHHHHHhhCc-eE
Q 018747          129 GALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGK-VN  207 (351)
Q Consensus       129 ~i~~~l~~~~~ii~~s~~~~~~~~~l~~~~~~~~~~~v~~pv~~~~~~~~~g~~~~~~~g~~~~~~~v~~ll~~~g~-~~  207 (351)
                      .+.+.+++++++||+||++|..++++.+.+...|..|+|+|++|+...+..|++++++||+++.+++++++|+.+|. ++
T Consensus        80 g~~~~~~~G~i~IDmSTisp~~a~~~a~~~~~~G~~~lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~~~g~~i~  159 (286)
T COG2084          80 GLLEGLKPGAIVIDMSTISPETARELAAALAAKGLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIV  159 (286)
T ss_pred             chhhcCCCCCEEEECCCCCHHHHHHHHHHHHhcCCcEEecCccCCchhhhhCceEEEeCCCHHHHHHHHHHHHHhcCceE
Confidence            88888999999999999999999999999999999999999999999999999999999999999999999999999 99


Q ss_pred             EcCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhcCCCCchhhhhhhhhcccCCCCCccchhhHHH
Q 018747          208 YMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVK  287 (351)
Q Consensus       208 ~~g~~g~a~~~kl~~n~~~~~~~~~~~Ea~~la~~~Gi~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~k  287 (351)
                      ++|+.|.++..|+++|++...++.++.|++.++++.|++++.+.+++..+..++|.++.+.+++.+++|.|+|.++.+.|
T Consensus       160 ~~G~~G~G~~~Kl~nn~l~~~~~~a~aEAl~la~k~Gld~~~~~~vi~~~~~~s~~~e~~~~~m~~~~~~p~F~v~~~~K  239 (286)
T COG2084         160 HVGPVGAGQAAKLANNILLAGNIAALAEALALAEKAGLDPDVVLEVISGGAAGSWILENYGPRMLEGDFSPGFAVDLMLK  239 (286)
T ss_pred             EECCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhccccCChHHHhhcchhhcCCCCcchhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHcCCCCCChHHHHHHHH
Q 018747          288 DLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALE  334 (351)
Q Consensus       288 d~~~~~~~a~~~gv~~p~~~~~~~l~~~~~~~g~~~~d~~~~~~~~~  334 (351)
                      |++++.+.+++.|+++|+...+.++++.+.+.|+++.|++++++.++
T Consensus       240 Dl~la~~~A~~~g~~lP~~~~~~~ly~~~~~~G~g~~D~sal~~~l~  286 (286)
T COG2084         240 DLGLALDAAKELGAPLPLTALAAELYAKAAAAGGGEEDFSALIKLLE  286 (286)
T ss_pred             HHHHHHHHHHhcCCCCcHHHHHHHHHHHHHhcCCCccChHHHHHHhC
Confidence            99999999999999999999999999999999999999999998764



>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
1vpd_A299 X-Ray Crystal Structure Of Tartronate Semialdehyde 2e-35
1yb4_A295 Crystal Structure Of The Tartronic Semialdehyde Red 3e-32
2uyy_A316 Structure Of The Cytokine-Like Nuclear Factor N-Pac 4e-32
3pef_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 1e-30
3pdu_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 1e-28
4dll_A320 Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Re 3e-28
3cky_A301 Structural And Kinetic Properties Of A Beta-Hydroxy 3e-27
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 1e-26
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 8e-22
2cvz_A289 Structure Of Hydroxyisobutyrate Dehydrogenase From 6e-20
2gf2_A296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 3e-18
2i9p_A319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 3e-18
3obb_A300 Crystal Structure Of A Possible 3-Hydroxyisobutyrat 4e-14
3q3c_A299 Crystal Structure Of A Serine Dehydrogenase From Ps 5e-14
3qha_A296 Crystal Structure Of A Putative Oxidoreductase From 3e-10
4gbj_A297 Crystal Structure Of Nad-Binding 6-Phosphogluconate 4e-10
2zya_A 480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 2e-08
3fwn_A 480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 2e-08
2zyg_A 480 Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenas 4e-08
3g0o_A303 Crystal Structure Of 3-Hydroxyisobutyrate Dehydroge 7e-07
2w8z_A 470 Geobacillus Stearothermophilus 6-Phosphogluconate D 1e-06
2w90_A 471 Geobacillus Stearothermophilus 6-Phosphogluconate D 1e-06
2iz0_A 474 Pex Inhibitor-Home Data Length = 474 3e-06
2iyo_A 472 Structural Characterization Of A Bacterial 6pdh Rev 3e-06
2iyp_A 473 Product Rup Length = 473 3e-06
>pdb|1VPD|A Chain A, X-Ray Crystal Structure Of Tartronate Semialdehyde Reductase [salmonella Typhimurium Lt2] Length = 299 Back     alignment and structure

Iteration: 1

Score = 146 bits (369), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 93/292 (31%), Positives = 144/292 (49%), Gaps = 2/292 (0%) Query: 51 RIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVF 110 ++G+IG G+ G+ +LL AGY++ V +R ++ GA A + ++A Q DV+ Sbjct: 7 KVGFIGLGIXGKPXSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVII 66 Query: 111 SIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTXXXXXXXXXXXXXXXKNCSAIDAPV 170 + + V+ V L +G + G +PG +++D ++ K +DAPV Sbjct: 67 TXLPNSPHVKEVALG-ENGIIEGAKPGTVLIDXSSIAPLASREISDALKAKGVEXLDAPV 125 Query: 171 SGGDRGAKTGTLAIFAGGDESVVQKLNPLF-ALMGKVNYMGGSGKGQFAKLANQITIATT 229 SGG+ A GTL++ GGD+++ K L A G V + G G G KLANQ+ +A Sbjct: 126 SGGEPKAIDGTLSVXVGGDKAIFDKYYDLXKAXAGSVVHTGDIGAGNVTKLANQVIVALN 185 Query: 230 MVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILKRDFEPGFFVNHFVKDL 289 + E + A KAG+N +L AI G AGS LD + R+F+PGF ++ +KDL Sbjct: 186 IAAXSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPXVXDRNFKPGFRIDLHIKDL 245 Query: 290 GICLKECQNMXXXXXXXXXXXXXXXSLKAHGEGNLGTQALILALERLNNVRL 341 L + +L+A G GN AL E+L V + Sbjct: 246 ANALDTSHGVGAQLPLTAAVXEXXQALRADGHGNDDHSALACYYEKLAKVEV 297
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|2UYY|A Chain A, Structure Of The Cytokine-Like Nuclear Factor N-Pac Length = 316 Back     alignment and structure
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|4DLL|A Chain A, Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Reductase From Polaromonas Sp. Js666 Length = 320 Back     alignment and structure
>pdb|3CKY|A Chain A, Structural And Kinetic Properties Of A Beta-Hydroxyacid Dehydrogenase Involved In Nicotinate Fermentation Length = 301 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2CVZ|A Chain A, Structure Of Hydroxyisobutyrate Dehydrogenase From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure
>pdb|3OBB|A Chain A, Crystal Structure Of A Possible 3-Hydroxyisobutyrate Dehydrogenase From Pseudomonas Aeruginosa Pao1 Length = 300 Back     alignment and structure
>pdb|3Q3C|A Chain A, Crystal Structure Of A Serine Dehydrogenase From Pseudomonas Aeruginosa Pao1 In Complex With Nad Length = 299 Back     alignment and structure
>pdb|3QHA|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Mycobacterium Avium 104 Length = 296 Back     alignment and structure
>pdb|4GBJ|A Chain A, Crystal Structure Of Nad-Binding 6-Phosphogluconate Dehydrogenase From Dyadobacter Fermentans Length = 297 Back     alignment and structure
>pdb|2ZYA|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate Length = 480 Back     alignment and structure
>pdb|3FWN|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate And 2'-Monophosphoadenosine-5'-Diphosphate Length = 480 Back     alignment and structure
>pdb|2ZYG|A Chain A, Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenase Length = 480 Back     alignment and structure
>pdb|3G0O|A Chain A, Crystal Structure Of 3-Hydroxyisobutyrate Dehydrogenase (Ygbj) From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470 Back     alignment and structure
>pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 471 Back     alignment and structure
>pdb|2IZ0|A Chain A, Pex Inhibitor-Home Data Length = 474 Back     alignment and structure
>pdb|2IYO|A Chain A, Structural Characterization Of A Bacterial 6pdh Reveals Aspects Of Specificity, Mechanism And Mode Of Inhibition Length = 472 Back     alignment and structure
>pdb|2IYP|A Chain A, Product Rup Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 1e-149
1yb4_A295 Tartronic semialdehyde reductase; structural genom 1e-145
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 1e-143
1vpd_A299 Tartronate semialdehyde reductase; structural geno 1e-143
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 1e-143
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 1e-140
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 1e-138
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 1e-118
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 1e-115
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 1e-111
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 1e-105
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 1e-104
3l6d_A306 Putative oxidoreductase; structural genomics, prot 7e-95
3qha_A296 Putative oxidoreductase; seattle structural genomi 3e-93
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 1e-53
4ezb_A317 Uncharacterized conserved protein; structural geno 8e-40
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 2e-34
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 2e-19
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 1e-18
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 2e-15
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 8e-15
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 1e-12
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 2e-12
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 5e-12
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 3e-11
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 5e-11
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 1e-10
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 2e-09
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 4e-08
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 1e-07
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 2e-07
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 3e-06
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 3e-06
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 4e-06
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 4e-06
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 5e-06
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 7e-06
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 7e-06
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 4e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 4e-05
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 8e-05
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 1e-04
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 2e-04
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 2e-04
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 2e-04
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 2e-04
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 4e-04
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 8e-04
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 8e-04
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
 Score =  423 bits (1089), Expect = e-149
 Identities = 98/306 (32%), Positives = 161/306 (52%), Gaps = 2/306 (0%)

Query: 34  RSMATVASTDPVCPTNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGA 93
            ++   + T    P   +I ++GTG MG  M   L  AGY + V+NRT ++A  L  +GA
Sbjct: 16  ENLYFQSMTVESDPYARKITFLGTGSMGLPMARRLCEAGYALQVWNRTPARAASLAALGA 75

Query: 94  HLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASE 153
            + +   + A  +D+V S++   + V+ VL   + G  + ++PG + +DM +  P  A +
Sbjct: 76  TIHEQARAAARDADIVVSMLENGAVVQDVLF--AQGVAAAMKPGSLFLDMASITPREARD 133

Query: 154 LSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGKVNYMGGSG 213
            +A   +   + +D PVSGG  GA+ GTL I AGG  +  ++  PL  + G+  ++G  G
Sbjct: 134 HAARLGALGIAHLDTPVSGGTVGAEQGTLVIMAGGKPADFERSLPLLKVFGRATHVGPHG 193

Query: 214 KGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGSRILK 273
            GQ  KLANQ+ +  T+  + E +++A K G ++     AI+ G A S+ L LHG R+++
Sbjct: 194 SGQLTKLANQMIVGITIGAVAEALLFATKGGADMAKVKEAITGGFADSRVLQLHGQRMVE 253

Query: 274 RDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILAL 333
           RDF P   ++  +KD+   L   Q +G   P   L +QLY     HG  +L    L + L
Sbjct: 254 RDFAPRARLSIQLKDMRNALATAQEIGFDAPITGLFEQLYAEGVEHGLTDLDQSGLFVEL 313

Query: 334 ERLNNV 339
              N +
Sbjct: 314 ASRNGM 319


>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Length = 276 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Length = 209 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Length = 259 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Length = 247 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Length = 245 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Length = 280 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Length = 322 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Length = 404 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Length = 236 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Length = 212 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Length = 262 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.98
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.98
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.97
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.97
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.97
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.97
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.96
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.96
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.95
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.95
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.95
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.95
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.95
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.94
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.94
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.93
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.92
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.92
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.92
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.92
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.91
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.91
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.91
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.91
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.91
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.91
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.9
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.9
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.9
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.89
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.88
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.88
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.88
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.87
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.87
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.87
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.86
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.85
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.84
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.84
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.84
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.84
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.83
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.81
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.8
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.79
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.77
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.77
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.77
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.77
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.76
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.75
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.75
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.74
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.74
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.73
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.73
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.72
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.54
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.65
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.64
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.63
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.62
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.57
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.57
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.56
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.49
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.41
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.36
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.35
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.34
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.32
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.32
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.3
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.3
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.28
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.28
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.28
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.28
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.27
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.26
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.26
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.26
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.25
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.25
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.25
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.23
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.23
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.23
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.23
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.22
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.21
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.2
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.2
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 99.2
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.2
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.2
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.18
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.17
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.15
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 99.15
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.13
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.13
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.11
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.07
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.06
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.04
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 99.02
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 99.01
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.99
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.94
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.94
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.92
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.91
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.9
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.9
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.9
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.89
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.88
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.88
2duw_A145 Putative COA-binding protein; ligand binding prote 98.87
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.87
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.87
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.86
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.86
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.84
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.81
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.81
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.8
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.8
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.8
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.79
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.79
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.79
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.79
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.79
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.78
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.78
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.77
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.77
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.76
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 98.75
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.75
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 98.74
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.74
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.73
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.72
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.72
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.72
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.72
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.71
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.71
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.7
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.7
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.7
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.7
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.69
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.69
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.67
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.66
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.65
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.65
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.63
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.63
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.62
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.59
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.59
1ydw_A362 AX110P-like protein; structural genomics, protein 98.59
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.57
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 98.56
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 98.56
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.55
4had_A350 Probable oxidoreductase protein; structural genomi 98.54
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.51
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.51
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 98.51
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.5
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.5
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.49
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 98.49
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.49
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.48
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.47
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.47
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.47
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.46
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.46
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.44
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 98.42
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.42
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 98.41
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 98.41
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 98.41
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.41
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 98.39
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.39
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.39
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.38
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 98.38
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.38
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.38
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.37
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.36
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.35
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.35
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 98.35
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 98.35
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.35
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.35
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.33
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.32
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 98.32
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.32
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.31
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.31
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 98.3
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.29
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.29
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 98.26
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.25
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 98.25
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.25
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.25
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.24
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.24
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.22
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.22
3oqb_A383 Oxidoreductase; structural genomics, protein struc 98.21
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 98.2
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 98.2
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.16
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.15
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.15
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.15
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.15
4h3v_A390 Oxidoreductase domain protein; structural genomics 98.13
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.13
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.11
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 98.11
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.1
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 98.1
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.1
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 98.1
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.09
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.09
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.09
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.08
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.08
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.08
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 98.07
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.07
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.03
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.98
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.94
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.93
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.93
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.92
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.91
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.9
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.9
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.87
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.83
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.83
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.81
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.8
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.8
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.8
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.79
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.78
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.75
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.72
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.69
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.69
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 97.68
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.67
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.67
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.67
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.65
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.65
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.63
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.62
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 97.61
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.61
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.6
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.58
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.55
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.54
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.52
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.49
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.49
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.49
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.48
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 97.47
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 97.43
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.43
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.42
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.42
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.4
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.4
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.37
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.37
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.35
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.35
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.35
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.34
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.3
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.26
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.26
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.26
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 97.23
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.21
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.19
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.18
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.15
1lnq_A336 MTHK channels, potassium channel related protein; 97.15
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 97.13
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 97.12
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.1
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.1
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.1
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.1
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.09
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.07
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.06
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.06
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.05
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.04
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.02
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.98
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.98
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 96.97
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.95
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.94
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.93
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.91
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.9
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.89
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.89
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.89
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 96.88
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.88
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.88
1xq6_A253 Unknown protein; structural genomics, protein stru 96.87
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.84
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.83
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.81
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 96.8
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.79
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.77
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.77
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.76
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.74
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.72
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 96.71
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.65
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.58
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.58
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.56
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.54
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.54
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 96.52
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.52
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.52
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 96.52
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 96.5
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.49
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 96.48
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 96.46
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.44
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 96.44
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.39
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.38
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.37
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.36
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.35
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 96.35
4hb9_A 412 Similarities with probable monooxygenase; flavin, 96.32
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 96.3
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.3
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 96.3
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.29
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.29
2csu_A 457 457AA long hypothetical protein; structural genomi 96.28
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.28
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.26
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.21
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.2
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.19
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 96.19
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 96.18
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.17
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.17
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.16
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.16
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.15
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.12
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.08
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 96.08
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 96.07
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.05
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 96.05
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.02
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 96.01
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.01
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 96.01
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 95.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.97
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 95.97
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.97
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.93
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 95.92
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 95.92
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.91
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.9
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 95.9
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.9
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 95.88
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 95.88
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 95.87
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 95.87
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 95.86
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 95.86
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.86
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 95.85
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 95.82
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 95.82
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 95.81
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 95.8
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 95.8
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.79
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.79
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 95.77
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.76
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 95.75
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.74
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.74
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 95.73
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.7
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 95.68
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 95.66
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.65
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 95.65
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.63
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.63
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.6
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 95.58
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.56
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 95.56
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.55
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 95.54
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 95.53
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 95.52
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.51
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.5
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 95.49
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.49
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 95.49
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.47
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.46
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.45
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.44
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.43
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 95.42
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.4
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 95.39
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 95.39
3rih_A293 Short chain dehydrogenase or reductase; structural 95.38
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 95.37
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.35
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.34
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 95.32
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.32
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 95.29
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.28
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.27
2ywl_A180 Thioredoxin reductase related protein; uncharacter 95.25
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.25
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 95.24
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
Probab=100.00  E-value=6.2e-51  Score=374.23  Aligned_cols=290  Identities=31%  Similarity=0.503  Sum_probs=275.6

Q ss_pred             CCCeEEEEccChhhHHHHHHHHHCCCeEEEEeCCcccchhHHhcCCcccCCHHHhhcCCCEEEEecCChhHHHHHhhCCC
Q 018747           48 TNTRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPS  127 (351)
Q Consensus        48 ~~~kI~iIG~G~mG~~ia~~L~~~g~~V~~~dr~~~~~~~~~~~g~~~~~~~~~~~~~~DiIi~~vp~~~~~~~v~~~~~  127 (351)
                      .|+||||||+|.||..||++|.++||+|++|||++++.+.+.+.|...++++.|+++++|+||+|+|.+.++++++.+..
T Consensus         2 ~M~kIgfIGlG~MG~~mA~~L~~~G~~v~v~dr~~~~~~~l~~~Ga~~a~s~~e~~~~~dvv~~~l~~~~~v~~V~~~~~   81 (300)
T 3obb_A            2 HMKQIAFIGLGHMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDD   81 (300)
T ss_dssp             -CCEEEEECCSTTHHHHHHHHHHTTCEEEEECSSHHHHHHHHHTTCEECSSHHHHHTTCSEEEECCSCHHHHHHHHHSSS
T ss_pred             CcCEEEEeeehHHHHHHHHHHHhCCCeEEEEcCCHHHHHHHHHcCCEEcCCHHHHHhcCCceeecCCchHHHHHHHhchh
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999998665


Q ss_pred             CCcccCCCCCcEEEecCCCChhHHHHHHHHHhcCCCcEEeccCCCCchhhccCceeEEecCCHHHHHHHHHHHHhhCc-e
Q 018747          128 SGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGK-V  206 (351)
Q Consensus       128 ~~i~~~l~~~~~ii~~s~~~~~~~~~l~~~~~~~~~~~v~~pv~~~~~~~~~g~~~~~~~g~~~~~~~v~~ll~~~g~-~  206 (351)
                       .+.+.+.++++|||+||+.|..++++.+.+.++|+.|+|+|++|++..+..|++++++||+++.+++++++|+.+|. +
T Consensus        82 -g~~~~~~~g~iiId~sT~~p~~~~~~a~~~~~~G~~~lDaPVsGg~~~A~~G~L~imvGG~~~~~~~~~p~l~~~g~~i  160 (300)
T 3obb_A           82 -GLLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNI  160 (300)
T ss_dssp             -SSTTSCCC-CEEEECSCCCHHHHHHHHHHHHTTTCEEEECCEESCHHHHHHTCEEEEEESCHHHHHHHHHHHHHHEEEE
T ss_pred             -hhhhcCCCCCEEEECCCCCHHHHHHHHHHHHHcCCEEEecCCCCCHHHHHhCCEEEEEeCCHHHHHHHHHHHHHhCCCE
Confidence             78888999999999999999999999999999999999999999999999999999999999999999999999998 9


Q ss_pred             EEcCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhcCCCCchhhhhhhh-------hcccCCCCCc
Q 018747          207 NYMGGSGKGQFAKLANQITIATTMVGLVEGMVYAHKAGLNVELFLNAISTGAAGSKSLDLHGS-------RILKRDFEPG  279 (351)
Q Consensus       207 ~~~g~~g~a~~~kl~~n~~~~~~~~~~~Ea~~la~~~Gi~~~~~~~~~~~~~~~s~~~~~~~~-------~~~~~~~~~~  279 (351)
                      +|+|+.|.+...|+++|.+...++.+++|++.++++.|++++.+.+++..+...++.++.+.|       .+..++|.++
T Consensus       161 ~~~G~~G~g~~~Kl~~N~l~~~~~~a~aEa~~la~~~Gld~~~~~~vl~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~~  240 (300)
T 3obb_A          161 FHAGPDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGG  240 (300)
T ss_dssp             EEEESTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHTSTTCCHHHHHCCCSTTTSTTSGGGGTTCSS
T ss_pred             EEeCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhCcccchHHHhhccccchhhhccccccCCcc
Confidence            999999999999999999999999999999999999999999999999999999999887765       3566789999


Q ss_pred             cchhhHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHcCCCCCChHHHHHHHHHhcC
Q 018747          280 FFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNN  338 (351)
Q Consensus       280 ~~~~~~~kd~~~~~~~a~~~gv~~p~~~~~~~l~~~~~~~g~~~~d~~~~~~~~~~~~~  338 (351)
                      |+++.+.||++++.+++++.|+++|+.+.+.++++++.++|+++.|++++++.|++..|
T Consensus       241 f~~~l~~KDl~l~~~~A~~~g~~~p~~~~a~~~~~~a~~~G~g~~D~sal~~~~e~~~G  299 (300)
T 3obb_A          241 FMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPTQG  299 (300)
T ss_dssp             SBHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHTTCTTSBGGGGHHHHCTTC-
T ss_pred             chHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHhCCCCCcCHHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999998776



>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 4e-36
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 4e-33
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 9e-28
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 1e-27
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 7e-26
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 2e-24
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 5e-23
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 8e-23
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 3e-19
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 1e-18
d2pv7a2152 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA { 9e-14
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 3e-11
d2ahra2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 4e-08
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 7e-08
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 2e-07
d1yqga2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 8e-07
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 8e-06
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 5e-05
d1gpja2159 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle 8e-05
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 1e-04
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 8e-04
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 0.001
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 0.002
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 0.003
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.003
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]
 Score =  126 bits (318), Expect = 4e-36
 Identities = 54/161 (33%), Positives = 92/161 (57%), Gaps = 2/161 (1%)

Query: 51  RIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVF 110
           ++G+IG G+MG+ M  +LL AGY++ V +R       ++  GA  A +  ++A Q DV+ 
Sbjct: 2   KVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVII 61

Query: 111 SIVGYPSDVRHVLLHPSSGALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPV 170
           +++     V+ V L   +G + G +PG +++DM++  P  + E+S A  +K    +DAPV
Sbjct: 62  TMLPNSPHVKEVALGE-NGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPV 120

Query: 171 SGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGK-VNYMG 210
           SGG+  A  GTL++  GGD+++  K   L   M   V + G
Sbjct: 121 SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG 161


>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Length = 152 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Length = 152 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 152 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 159 Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.96
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.96
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.91
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.89
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.89
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.87
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.86
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.84
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.83
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.82
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.78
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.76
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.76
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.75
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.7
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.68
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.55
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.52
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.51
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.45
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.42
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.41
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 99.16
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.13
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.08
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.04
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.04
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.94
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.92
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 98.9
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 98.9
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.84
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.73
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.64
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.63
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.6
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.59
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.55
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.51
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.49
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.49
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.49
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.47
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.45
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.44
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.42
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.38
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.38
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.31
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.3
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.3
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.29
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.29
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.29
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.29
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.28
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.28
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.24
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.24
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.21
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.2
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.18
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.16
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 98.09
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.08
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 98.08
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.06
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.05
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.05
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 98.04
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 98.03
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.03
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.01
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.98
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.95
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.93
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.9
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.89
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.86
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.86
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.86
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.86
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.85
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.8
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.73
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 97.73
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 97.67
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.66
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.66
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.65
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.64
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.62
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.6
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.59
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.59
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 97.58
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.58
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 97.58
d2pgda1 297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 97.57
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.55
d1pgja1 300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 97.52
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.52
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.5
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 97.48
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.48
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 97.41
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 97.38
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.35
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.33
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.32
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.24
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.23
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.22
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.16
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.12
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.07
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.06
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.06
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.95
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.92
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.92
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.9
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.89
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.89
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.87
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.85
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.85
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.83
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.8
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.78
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.73
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.67
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.67
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.64
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.53
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.49
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.49
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.42
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.4
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.4
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.39
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.37
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.36
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.32
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.27
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.25
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.23
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.23
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.22
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.19
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.18
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.17
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.15
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.15
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.11
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.07
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.05
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.04
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.02
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.99
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.97
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.95
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.94
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.94
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.91
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.88
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 95.87
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 95.85
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.85
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.83
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.83
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.8
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 95.78
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.77
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 95.75
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.74
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.72
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.71
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.71
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.7
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.69
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.65
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.64
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 95.63
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 95.62
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.61
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 95.58
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.57
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.57
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.56
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 95.56
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.54
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.52
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.5
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.46
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 95.46
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.44
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.44
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.43
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.41
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.41
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.31
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 95.31
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 95.3
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.29
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.26
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.23
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.22
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.2
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.19
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.16
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.13
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 95.07
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 95.06
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 95.04
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 95.02
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.02
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.0
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 94.99
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 94.93
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.91
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.89
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 94.86
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.85
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.76
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.76
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.67
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.65
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.64
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.53
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 94.53
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.5
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 94.49
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.49
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 94.42
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 94.39
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.32
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.31
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.28
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.26
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 94.24
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.21
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.13
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 94.06
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 93.99
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 93.97
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 93.92
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 93.84
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.8
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.77
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 93.72
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.58
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 93.54
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 93.48
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 93.44
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 93.42
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 93.36
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 93.29
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.27
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.22
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 93.22
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 93.18
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 93.16
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 93.08
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.96
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.72
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 92.69
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.57
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.57
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.46
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.44
d1yqga1111 Pyrroline-5-carboxylate reductase ProC {Neisseria 92.42
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 92.39
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.18
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.13
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.08
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.08
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.06
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.03
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.0
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 91.92
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 91.87
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.76
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 91.41
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 91.22
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 91.21
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.17
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.11
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 91.09
d2ahra1104 Pyrroline-5-carboxylate reductase ProC {Streptococ 91.08
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 91.04
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 90.96
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 90.69
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 90.64
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.6
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 90.45
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 90.41
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.25
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 90.07
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 89.99
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.84
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.78
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 89.67
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 89.65
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.65
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 89.6
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 89.52
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.21
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.11
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 88.76
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.7
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 88.59
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.44
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 88.23
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 88.14
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 88.13
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 87.39
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.32
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.31
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.3
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.23
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.14
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 87.09
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.91
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 86.9
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 86.74
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 86.39
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 86.24
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 86.17
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 85.78
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 85.72
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.56
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 85.53
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 85.45
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 85.4
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 85.33
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 85.17
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 85.17
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 85.15
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 84.87
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.82
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 84.77
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 84.7
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 84.4
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.36
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 84.29
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 84.13
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 84.0
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 83.75
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 83.7
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 83.49
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.43
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 83.23
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 83.13
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 82.89
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 82.86
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 82.74
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 82.68
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 82.66
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 82.66
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 82.62
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 82.57
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 82.56
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 82.34
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 82.05
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 81.92
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 81.6
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 81.52
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.35
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 81.31
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 81.26
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 81.24
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 81.14
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 80.62
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 80.53
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 80.46
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 80.41
d1bg6a1172 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 80.39
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 80.02
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.96  E-value=1e-29  Score=210.62  Aligned_cols=160  Identities=34%  Similarity=0.632  Sum_probs=151.1

Q ss_pred             CeEEEEccChhhHHHHHHHHHCCCeEEEEeCCcccchhHHhcCCcccCCHHHhhcCCCEEEEecCChhHHHHHhhCCCCC
Q 018747           50 TRIGWIGTGVMGRSMCAHLLNAGYTVTVFNRTLSKAQPLLDIGAHLADSPHSLASQSDVVFSIVGYPSDVRHVLLHPSSG  129 (351)
Q Consensus        50 ~kI~iIG~G~mG~~ia~~L~~~g~~V~~~dr~~~~~~~~~~~g~~~~~~~~~~~~~~DiIi~~vp~~~~~~~v~~~~~~~  129 (351)
                      |||||||+|.||..||++|.++||+|++|||++++.+.+.+.+.....++.++++++|+||+|||++.++++++...+ .
T Consensus         1 MkIgiIGlG~MG~~~A~~L~~~G~~V~~~d~~~~~~~~~~~~~~~~~~~~~e~~~~~d~ii~~v~~~~~v~~v~~~~~-~   79 (161)
T d1vpda2           1 MKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGEN-G   79 (161)
T ss_dssp             CEEEEECCSTTHHHHHHHHHHTTCEEEEECSCHHHHHHHHHTTCEECSSHHHHHHHCSEEEECCSSHHHHHHHHHSTT-C
T ss_pred             CEEEEEehhHHHHHHHHHHHHCCCeEEEEeCCcchhHHHHHhhhhhcccHHHHHhCCCeEEEEcCCHHHHHHHHhCCc-c
Confidence            799999999999999999999999999999999999999999999999999999999999999999999999996444 6


Q ss_pred             cccCCCCCcEEEecCCCChhHHHHHHHHHhcCCCcEEeccCCCCchhhccCceeEEecCCHHHHHHHHHHHHhhCc-eEE
Q 018747          130 ALSGLRPGGIIVDMTTSEPSLASELSAAASSKNCSAIDAPVSGGDRGAKTGTLAIFAGGDESVVQKLNPLFALMGK-VNY  208 (351)
Q Consensus       130 i~~~l~~~~~ii~~s~~~~~~~~~l~~~~~~~~~~~v~~pv~~~~~~~~~g~~~~~~~g~~~~~~~v~~ll~~~g~-~~~  208 (351)
                      +.+.+.++++|||++|+.|...+++.+.+..+++.|+++|+++++..+..|.+.++++|+++.+++++++|+.++. ++|
T Consensus        80 ~~~~~~~g~iiid~sT~~p~~~~~~~~~~~~~g~~~vdapv~gg~~~a~~g~l~~~~gG~~~~~~~~~~il~~~~~~i~~  159 (161)
T d1vpda2          80 IIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVH  159 (161)
T ss_dssp             HHHHCCTTCEEEECSCCCHHHHHHHHHHHHTTTCEEEECCEESHHHHHHHTCEEEEEESCHHHHHHHHHHHHTTEEEEEE
T ss_pred             hhhccCCCCEEEECCCCCHHHHHHHHHHHHHcCCceecccccCChhHHhcCCeEEEEcCCHHHHHHHHHHHHHhcCceEE
Confidence            7788899999999999999999999999999999999999999999999999999999999999999999999998 887


Q ss_pred             cC
Q 018747          209 MG  210 (351)
Q Consensus       209 ~g  210 (351)
                      +|
T Consensus       160 ~G  161 (161)
T d1vpda2         160 TG  161 (161)
T ss_dssp             EE
T ss_pred             CC
Confidence            65



>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1bg6a1 a.100.1.5 (A:188-359) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure