Citrus Sinensis ID: 018797


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MGFQRSPSSKQKVKPISKENNDENGGDHSINERTTSNPPDSVTSDASYNSWMMEHPSALGSFDKMMKAAKEKKIAVFLNYDGTLSPIVDDPDRVFMSDEMRAAVREVAKYFPTAIISGRSREKVMGFVELCNVYYAGSHGMDILAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSILQEKAKAVLRNYPDFDLSEGKKVMEIRPSIEWDKGHALEYLLDTLGLSNPNDVLPLYIGDDRTDEDAFKVIKGRGQGYPIIVSSTPKETKASYSLNDPSEVLTFLLRLSRWRKSSSSSKQLAQIWGIGY
cccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHccccEEEEccccHHHHHHHcccccccEECcccccccccccccccccccccccccccccccCEccccccccHHHHHHHHHHHHHHHcccccEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEccccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHcccccEEEEEccccccccEEEEcccHHHHHHHHHHHHHHcccccccccccccccccc
***********************NGG*HSI**************************SALGSFDKMMKAAKEKKIAVFLNYDGTLSPIVDDPDRVFMSDEMRAAVREVAKYFPTAIISGRSREKVMGFVELCNVYYAGSHGMDILAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSILQEKAKAVLRNYPDFDLSEGKKVMEIRPSIEWDKGHALEYLLDTLGLSNPNDVLPLYIGDDRTDEDAFKVIKGRGQGYPIIVSSTPKETKASYSLNDPSEVLTFLLRLSR*************IWGIGY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFQRSPSSKQKVKPISKENNDENGGDHSINERTTSNPPDSVTSDASYNSWMMEHPSALGSFDKMMKAAKEKKIAVFLNYDGTLSPIVDDPDRVFMSDEMRAAVREVAKYFPTAIISGRSREKVMGFVELCNVYYAGSHGMDILAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAxxxxxxxxxxxxxxxxxxxxxDNRFCISVHFRQVREEDYSILQEKAKAVLRNYPDFDLSEGKKVMEIRPSIEWDKGHALEYLLDTLGLSNPNDVLPLYIGDDRTDEDAFKVIKGRGQGYPIIVSSTPKETKASYSLNDPSEVLTFLLRLSRWRKSSSSSKQLAQIWGIGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trehalose-phosphate phosphatase A Removes the phosphate from trehalose 6-phosphate to produce free trehalose. Trehalose accumulation in plant may improve abiotic stress tolerance.probableO64896
Probable trehalose-phosphate phosphatase 7 Removes the phosphate from trehalose 6-phosphate to produce free trehalose. Trehalose accumulation in plant may improve abiotic stress tolerance.probableQ6H5L4
Probable trehalose-phosphate phosphatase 4 Removes the phosphate from trehalose 6-phosphate to produce free trehalose. Trehalose accumulation in plant may improve abiotic stress tolerance.probableQ6ZGP8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U02, chain A
Confidence level:very confident
Coverage over the Query: 74-154,167-334
View the alignment between query and template
View the model in PyMOL
Template: 2ZOS, chain A
Confidence level:confident
Coverage over the Query: 73-151,163-321
View the alignment between query and template
View the model in PyMOL
Template: 3RFU, chain A
Confidence level:probable
Coverage over the Query: 50-134,149,243-327
View the alignment between query and template
View the model in PyMOL