Citrus Sinensis ID: 018807


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MFKVYPGQRTGGIEADMMAANELNAHAFLQSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHSAGESSWNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQVEIVFKVYRLSITPQILAIYVHIWKSHMGFSPLQSPAFQEFIDKFLYGYVISLAAMLNPDFQQRPIAEAVINHRFTAGAVL
ccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccccccCECccccccccccccccccccccccccccccHHccccccHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcHHcccccc
*FK******T****ADMMAANELNAHAFLQSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLT**************WNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQVEIVFKVYRLSITPQILAIYVHIWKSHMGFSPLQSPAFQEFIDKFLYGYVISLAAMLNPDFQQRPIAEAVINHRFTAGAVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKVYPGQRTGGIEADMMAANELNAHAFLQSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHSAGESSWNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQVEIVFKVYRLSITPQILAIYVHIWKSHMGFSPLQSPAFQEFIDKFLYGYVISLAAMLNPDFQQRPIAEAVINHRFTAGAVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X7F, chain A
Confidence level:very confident
Coverage over the Query: 18-76,90-157,169-233,278-280,295-312,324-347
View the alignment between query and template
View the model in PyMOL
Template: 3NYV, chain A
Confidence level:very confident
Coverage over the Query: 17-74,90-249,300-312,324-347
View the alignment between query and template
View the model in PyMOL
Template: 4F9C, chain A
Confidence level:confident
Coverage over the Query: 18-74,101-275,300-312,324-348
View the alignment between query and template
View the model in PyMOL
Template: 3HKO, chain A
Confidence level:confident
Coverage over the Query: 18-234,245-248,299-312,324-348
View the alignment between query and template
View the model in PyMOL