Citrus Sinensis ID: 018860

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MDKKKIAVPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSSPMLRNGETGDWIGTFEGHKGAVWSCCLDTNALRAASASADFSAKVWDALTGDVLHSFEHKHIVRACSFSEDTHLLLTGGMEKILRIFDLNRPDAPPREVDRSPGSVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGGEDMWVRFFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPVTNDDTETLTANGTIGKVKVTADEVSRKIEGFHIADEGKMKEKEEAAN
cccccccEEEEEEcccccEEEEEEccccccccEEEEECccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccccccEEccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEECccccEEEEEEcccccEEEECccccEEEEEcccccEEEEEECcccEEEEEECcccccEEEEEccccEEEEEEccccCEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEECccccEEEEEEccccccEEEEEEECcccccEEEECcccc
*DKKKIAVPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSSPMLRNGETGDWIGTFEGHKGAVWSCCLDTNALRAASASADFSAKVWDALTGDVLHSFEHKHIVRACSFSEDTHLLLTGGMEKILRIFDLNRPDAPPREVDRSPGSVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGGEDMWVRFFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPVTNDDTETLTANGTIGKVKVTADEVSRKIEGFHIADEGKMKEKE****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKKKIAVPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSSPMLRNGETGDWIGTFEGHKGAVWSCCLDTNALRAASASADFSAKVWDALTGDVLHSFEHKHIVRACSFSEDTHLLLTGGMEKILRIFDLNRPDAPPREVDRSPGSVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGGEDMWVRFFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPVTNDDTETLTANGTIGKVKVTADEVSRKIEGFHIADEGKMKEKEEAAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine-threonine kinase receptor-associated protein The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein.probableQ9Y3F4
Serine-threonine kinase receptor-associated protein The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein.probableQ5XIG8
Serine-threonine kinase receptor-associated protein The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein.probableQ9Z1Z2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZM, chain R
Confidence level:very confident
Coverage over the Query: 9-300
View the alignment between query and template
View the model in PyMOL
Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 11-324
View the alignment between query and template
View the model in PyMOL