Query         018866
Match_columns 349
No_of_seqs    118 out of 166
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 04:41:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/018866.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/018866hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05022 SRP40_C:  SRP40, C-ter 100.0 6.7E-34 1.5E-38  222.6   4.8   72  269-343     1-72  (72)
  2 KOG2992 Nucleolar GTPase/ATPas  99.7 1.2E-17 2.7E-22  165.6   4.4   80  264-346   367-446 (446)
  3 PF14975 DUF4512:  Domain of un  19.0      76  0.0017   26.7   1.8   21    3-23      8-29  (88)
  4 PF02395 Peptidase_S6:  Immunog  14.5      78  0.0017   35.0   1.0   17  329-345   453-469 (769)
  5 PF08694 UFC1:  Ubiquitin-fold   13.7      77  0.0017   29.3   0.6   12  328-339   106-117 (161)
  6 PF13074 DUF3938:  Protein of u  13.4 1.2E+02  0.0027   25.7   1.7   27    6-32     72-100 (102)
  7 KOG2992 Nucleolar GTPase/ATPas  12.8 1.4E+02  0.0031   31.3   2.3   21  261-281   361-381 (446)
  8 COG0292 RplT Ribosomal protein  11.7 1.3E+02  0.0028   26.8   1.4   12    5-16     58-69  (118)
  9 PF01102 Glycophorin_A:  Glycop  11.0 1.2E+02  0.0025   26.7   0.8    8   34-41    109-116 (122)
 10 PHA03049 IMV membrane protein;   8.3 2.5E+02  0.0053   23.0   1.7   15    1-17      1-15  (68)

No 1  
>PF05022 SRP40_C:  SRP40, C-terminal domain;  InterPro: IPR007718 This presumed domain is found at the C terminus of the Saccharomyces cerevisiae SRP40 protein P32583 from SWISSPROT and its homologues. SRP40/nopp40 is a chaperone involved in nucleocytoplasmic transport. SRP40 is also a suppressor of mutant AC40 subunit of RNA polymerase I and III.
Probab=100.00  E-value=6.7e-34  Score=222.63  Aligned_cols=72  Identities=65%  Similarity=0.927  Sum_probs=69.7

Q ss_pred             CCCccccCCceeeccccccCCcccccCCCCcchHHHHHhHhccccCCcccccccccccccccCceeecccceeeC
Q 018866          269 KAFQRVKVDEVEFTDERLKDNSYWAKDGAEIGYGAKAQEVLGQVRGRDFRHEKTKKKRGSYRGGQIDLQSHSVKF  343 (349)
Q Consensus       269 ~PFqRV~~eev~f~DerL~DNSYeAK~Ga~d~wGeKAnedL~~TRGKgFRKEKnKKKRGSYRGG~ID~svnSIKF  343 (349)
                      .|||||++++|+|+|++|+||||+++.   ++||++||++|++||||+|||||||||||||+||+||++||||||
T Consensus         1 ~pF~RV~~~~v~~~d~~l~dNsy~~~~---~~~G~kA~~~L~~trGK~FrkEK~KkKRgsy~GG~Id~~v~SiKF   72 (72)
T PF05022_consen    1 KPFQRVDEEKVEFVDERLKDNSYEAKF---DGWGEKANEDLIVTRGKGFRKEKNKKKRGSYRGGQIDTSVNSIKF   72 (72)
T ss_pred             CCCcccChhheeecCcccccCCCcccc---ChHHHHHHhhhccccCCCccccccccccccccCCeecCccceeeC
Confidence            499999999999999999999999975   689999999999999999999999999999999999999999999


No 2  
>KOG2992 consensus Nucleolar GTPase/ATPase p130 [Nuclear structure]
Probab=99.69  E-value=1.2e-17  Score=165.63  Aligned_cols=80  Identities=48%  Similarity=0.691  Sum_probs=68.1

Q ss_pred             CCCCCCCCccccCCceeeccccccCCcccccCCCCcchHHHHHhHhccccCCcccccccccccccccCceeecccceeeC
Q 018866          264 EPKSVKAFQRVKVDEVEFTDERLKDNSYWAKDGAEIGYGAKAQEVLGQVRGRDFRHEKTKKKRGSYRGGQIDLQSHSVKF  343 (349)
Q Consensus       264 ~pk~n~PFqRV~~eev~f~DerL~DNSYeAK~Ga~d~wGeKAnedL~~TRGKgFRKEKnKKKRGSYRGG~ID~svnSIKF  343 (349)
                      ..++..|||||++.++.++-..   |+|..+.|+.++||.+|+++|++|||++|||+|||||||+||||.|++.+++|+|
T Consensus       367 ~~t~~~~~r~~~~~kd~~~~~~---~~~~~~~~~~~~wG~~An~~l~~~rGk~fr~eKtkkkRgsy~gG~I~~~~~s~kF  443 (446)
T KOG2992|consen  367 SETKKSPFRRVDPVKDSRVEDI---LSDNKKDGAAGGWGKRANKDLGPGRGKDFRHEKTKKKRGSYRGGSITLDVNSIKF  443 (446)
T ss_pred             cccCCCCccccccccccccccc---cccccccccccccccccccccccccccccccccccccCccccCCccccccccccc
Confidence            3455579999977766654333   6666666788999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q 018866          344 NYS  346 (349)
Q Consensus       344 dDS  346 (349)
                      +++
T Consensus       444 ~~~  446 (446)
T KOG2992|consen  444 DLS  446 (446)
T ss_pred             CCC
Confidence            975


No 3  
>PF14975 DUF4512:  Domain of unknown function (DUF4512)
Probab=19.00  E-value=76  Score=26.68  Aligned_cols=21  Identities=24%  Similarity=0.428  Sum_probs=15.0

Q ss_pred             hhhHHHHH-HHhhhhhhhcccc
Q 018866            3 SVIALWIW-RICAASILRLDSQ   23 (349)
Q Consensus         3 ~~~~~~~~-~~~~~~~~~~~~~   23 (349)
                      .-|.|||| |+..--|+||=+.
T Consensus         8 IPvLLwIykkFlqP~i~~~~sp   29 (88)
T PF14975_consen    8 IPVLLWIYKKFLQPYIYPFWSP   29 (88)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCc
Confidence            34689999 5666677788764


No 4  
>PF02395 Peptidase_S6:  Immunoglobulin A1 protease Serine protease Prosite pattern;  InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S6 (clan PA(S)). The type sample being the IgA1-specific serine endopeptidase from Neisseria gonorrhoeae []. These cleave prolyl bonds in the hinge regions of immunoglobulin A heavy chains. Similar specificity is shown by the unrelated family of M26 metalloendopeptidases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SZE_A 3H09_B 3SYJ_A 1WXR_A 3AK5_B.
Probab=14.46  E-value=78  Score=34.95  Aligned_cols=17  Identities=35%  Similarity=0.915  Sum_probs=11.5

Q ss_pred             ccCceeecccceeeCCC
Q 018866          329 YRGGQIDLQSHSVKFNY  345 (349)
Q Consensus       329 YRGG~ID~svnSIKFdD  345 (349)
                      ||||.+|+..|++.|..
T Consensus       453 frGG~LDlNGn~ltF~~  469 (769)
T PF02395_consen  453 FRGGRLDLNGNDLTFKR  469 (769)
T ss_dssp             TT-EEEE-TT--EEESS
T ss_pred             ecCceeeccCccchhhh
Confidence            78999999999999963


No 5  
>PF08694 UFC1:  Ubiquitin-fold modifier-conjugating enzyme 1;  InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes. Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme [].; PDB: 2Z6P_A 2K07_A 2Z6O_A 3EVX_D 3KPA_A.
Probab=13.68  E-value=77  Score=29.31  Aligned_cols=12  Identities=58%  Similarity=1.030  Sum_probs=7.4

Q ss_pred             cccCceeecccc
Q 018866          328 SYRGGQIDLQSH  339 (349)
Q Consensus       328 SYRGG~ID~svn  339 (349)
                      -||||.|.+++|
T Consensus       106 MYRGGkIClt~H  117 (161)
T PF08694_consen  106 MYRGGKICLTDH  117 (161)
T ss_dssp             BCCCCBB---TT
T ss_pred             hhcCceEeeecc
Confidence            499999998865


No 6  
>PF13074 DUF3938:  Protein of unknown function (DUF3938)
Probab=13.37  E-value=1.2e+02  Score=25.71  Aligned_cols=27  Identities=37%  Similarity=0.776  Sum_probs=18.7

Q ss_pred             HHHHHHH--hhhhhhhcccccCCCCccch
Q 018866            6 ALWIWRI--CAASILRLDSQKDGDSKRGK   32 (349)
Q Consensus         6 ~~~~~~~--~~~~~~~~~~~~~~~s~~~~   32 (349)
                      .||.|-|  |.|-++.|-.....||-|..
T Consensus        72 glwtwfiafcladvfnllqdneedsgrqi  100 (102)
T PF13074_consen   72 GLWTWFIAFCLADVFNLLQDNEEDSGRQI  100 (102)
T ss_pred             hHHHHHHHHHHHHHHHHhcCchhhccCcC
Confidence            5788865  88888887665555665543


No 7  
>KOG2992 consensus Nucleolar GTPase/ATPase p130 [Nuclear structure]
Probab=12.83  E-value=1.4e+02  Score=31.31  Aligned_cols=21  Identities=5%  Similarity=-0.179  Sum_probs=15.0

Q ss_pred             CCCCCCCCCCCccccCCceee
Q 018866          261 GSAEPKSVKAFQRVKVDEVEF  281 (349)
Q Consensus       261 gs~~pk~n~PFqRV~~eev~f  281 (349)
                      +....+...+|.+++...+.+
T Consensus       361 ~~g~~~~~t~~~~~r~~~~~k  381 (446)
T KOG2992|consen  361 SGGGEGSETKKSPFRRVDPVK  381 (446)
T ss_pred             CCCccccccCCCCcccccccc
Confidence            445677777999998876554


No 8  
>COG0292 RplT Ribosomal protein L20 [Translation, ribosomal structure and biogenesis]
Probab=11.74  E-value=1.3e+02  Score=26.77  Aligned_cols=12  Identities=58%  Similarity=0.794  Sum_probs=10.1

Q ss_pred             hHHHHHHHhhhh
Q 018866            5 IALWIWRICAAS   16 (349)
Q Consensus         5 ~~~~~~~~~~~~   16 (349)
                      =.|||-||-||.
T Consensus        58 R~LWI~RINAA~   69 (118)
T COG0292          58 RKLWIARINAAA   69 (118)
T ss_pred             HHHHHHHHHHHH
Confidence            369999999885


No 9  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=10.99  E-value=1.2e+02  Score=26.65  Aligned_cols=8  Identities=25%  Similarity=0.231  Sum_probs=0.0

Q ss_pred             HHHhhhHH
Q 018866           34 AESAAGVE   41 (349)
Q Consensus        34 ~~~~~~~e   41 (349)
                      +.-+--||
T Consensus       109 ~~p~~~~~  116 (122)
T PF01102_consen  109 DVPLSSVE  116 (122)
T ss_dssp             --------
T ss_pred             CCCcceee
Confidence            33344444


No 10 
>PHA03049 IMV membrane protein; Provisional
Probab=8.32  E-value=2.5e+02  Score=23.00  Aligned_cols=15  Identities=53%  Similarity=0.718  Sum_probs=9.6

Q ss_pred             CchhhHHHHHHHhhhhh
Q 018866            1 MISVIALWIWRICAASI   17 (349)
Q Consensus         1 ~~~~~~~~~~~~~~~~~   17 (349)
                      ||+-++|.|  ||.|-|
T Consensus         1 MI~d~~l~i--ICVaIi   15 (68)
T PHA03049          1 MIGDIILVI--ICVVII   15 (68)
T ss_pred             ChHHHHHHH--HHHHHH
Confidence            677666655  677654


Done!