Citrus Sinensis ID: 018892

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MFVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEGLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAVDAFNDGGYNVANCMRAVAEPLLVSQFGEAIIDELFKRYREIVADRMSKEKTKFINVTVSLTKIG
ccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccccccCEEEEEcccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEEEcccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcc
MFVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEGLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAVDAFNDGGYNVANCMRAVAEPLLVSQFGEAIIDELFKRYREIVADRMSKEKTKFINVTVSLTKIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEGLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAVDAFNDGGYNVANCMRAVAEPLLVSQFGEAIIDELFKRYREIVADRMSKEKTKFINVTVSLTKIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Salicylate O-methyltransferase Catalyzes the methylation of the free carboxyl end of the plant hormone salicylic acid (SA). Converts SA to SA methyl ester (MSA). The volatile compound MSA is hypothesized to act as an airborne signal that triggers defense responses in uninfected plants. MSA is an important chemoattractant for moth pollinated flowering plants.probableQ9SPV4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M6E, chain X
Confidence level:very confident
Coverage over the Query: 2-349
View the alignment between query and template
View the model in PyMOL