Citrus Sinensis ID: 018897


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MEFSEHGFLEELLALRRDAYTWDTSIPAEMNQIFSDGNWIYDCFDENPAAFSPNSFSAPIHQQDHFNYNNFFNEAAYCPYGDDQLSAPQLTDSSSMNTLDSHTHTPPSFPIQEEAPLSMMELDGEEPNNLLADEFQNLEMLQNCFKVEPVHESPETLPVFNMGTDCLERKSRNKKLGGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILADTIDYMKELLDKISSLQQEIQAGSNNLETGIFKDVKPNEIVVRNSPKFDVERTNMDTRVEICCAGKPGLLLSTVTSLEALGLEIQQCVISCFNDFAMQASCSEGVEQRETLSCEDIKQALFRNAGYGGKCL
ccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEcccccccccHHHHHHHHHHHcccccccc
*EFSEHGFLEELLALRRDAYTWDTSIPAEMNQIFSDGNWIYDCFDENPAAFSPNSFSAPIHQQDHFNYNNFFNEAAYCPYG****************************************************EFQNLEMLQNCFKVEPV******LPVFNM*******************************LNDRLSMLRSIVPKISKMDRTSILADTIDYMKELLDKISSLQQEIQA********************RNSPKFDVERTNMDTRVEICCAGKPGLLLSTVTSLEALGLEIQQCVISCFNDFAMQASCSEGVEQRETLSCEDIKQALFRNAGYGG*C*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFSEHGFLEELLALRRDAYTWDTSIPAEMNQIFSDGNWIYDCFDENPAAFSPNSFSAPIHQQDHFNYNNFFNEAAYCPYGDDQLSAPQLTDSSSMNTLDSHTHTPPSFPIQEEAPLSMMELDGEEPNNLLADEFQNLEMLQNCFKVEPVHESPETLPVFNMGTDCLERKSRNKKLGGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxLETGIFKDVKPNEIVVRNSPKFDVERTNMDTRVEICCAGKPGLLLSTVTSLEALGLEIQQCVISCFNDFAMQASCSEGVEQRETLSCEDIKQALFRNAGYGGKCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor bHLH93 Transcription factor. May be involved in the differentiation of stomatal guard cells.probableQ9LSL1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HLO, chain A
Confidence level:confident
Coverage over the Query: 179-241
View the alignment between query and template
View the model in PyMOL
Template: 2NYI, chain A
Confidence level:probable
Coverage over the Query: 274-342
View the alignment between query and template
View the model in PyMOL