Citrus Sinensis ID: 018908


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELEVNGEANLVERSASSLEQHMASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQVGVCFLFSSESV
cHHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEEEEEccccEEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEcEEEEcccccccEEEEEEEEccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccccccEEECccccccccccccccCEEEECcccccHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccc
************************************************************************************************************************VIATTVG*******QTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQVGVCFLFSSE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELEVNGEANLVERSASSLEQHMASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQVGVCFLFSSESV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Shaggy-related protein kinase theta May mediate extracellular signals to regulate transcription in differentiating cells.probableQ96287
Glycogen synthase kinase-3 homolog MsK-1 probableP51137
Glycogen synthase kinase-3 homolog MsK-2 probableP51138

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E7W, chain A
Confidence level:very confident
Coverage over the Query: 135-340
View the alignment between query and template
View the model in PyMOL
Template: 1GNG, chain A
Confidence level:very confident
Coverage over the Query: 117-337
View the alignment between query and template
View the model in PyMOL
Template: 1Q3D, chain A
Confidence level:very confident
Coverage over the Query: 116-337
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:confident
Coverage over the Query: 41-337
View the alignment between query and template
View the model in PyMOL