BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 018935
(348 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OKB|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Atlantic
Cod (Gadus Morhua)
pdb|1OKB|B Chain B, Crystal Structure Of Uracil-Dna Glycosylase From Atlantic
Cod (Gadus Morhua)
Length = 223
Score = 34.3 bits (77), Expect = 0.10, Method: Compositional matrix adjust.
Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Query: 190 VEDVKAVLALKEYFDGRNEVSNL-LSLMKATVTRVDVAGMGDRVCVDLCSLMRPGEGLLV 248
++DVK V+ ++ + G N+ L S+ K + + +C D+ PG G L
Sbjct: 53 IQDVKVVILGQDPYHGPNQAHGLCFSVQKPVPPPPSLVNIYKELCTDIDGFKHPGHGDLS 112
Query: 249 GSFARGLFLVHS 260
G +G+ L+++
Sbjct: 113 GWAKQGVLLLNA 124
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.134 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,635,191
Number of Sequences: 62578
Number of extensions: 381799
Number of successful extensions: 1083
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1082
Number of HSP's gapped (non-prelim): 5
length of query: 348
length of database: 14,973,337
effective HSP length: 100
effective length of query: 248
effective length of database: 8,715,537
effective search space: 2161453176
effective search space used: 2161453176
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)