Citrus Sinensis ID: 018994

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35

MEMAKLCFSLLLLLQLCMQPAASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPRTDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNKDCLNDIQTFSKLTSGVEKSHILEPHCQFFSPKPRASSRNRRSLNVNEQSQEFLDPEPTFPPIGCRSYGYLLARYWDNDHNVRKALHIRQV

ccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccccEEEEEEEEECccccccccEEEEEcccccHHHHHHHHHHccccEECcccccccccccccccccccccccEEEECcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccccEEEEEEccccccccccccccHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHccccc

*EMAKLCFSLLLLLQLCMQPAASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPRTDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNKDCLNDIQTFSKLTSGVEKSHILEPHCQFFSP*********************LDPEPTFPPIGCRSYGYLLARYWDNDHNVRKALHIR**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine carboxypeptidase-like 19	Involved in plants secondary metabolism. Functions as acyltransferase to form the sinapate ester sinapoylcholine also known as sinapine. May rather catalyze a transesterification reaction rather than a hydrolysis. May also have carboxypeptidase activity.	probable	Q8VZU3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IVY, chain A
Confidence level:very confident
Coverage over the Query: 22-347
View the alignment between query and template
View the model in PyMOL