BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 019031
(347 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGK|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And An
Incomplete Jaz1 Degron
pdb|3OGL|B Chain B, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|D Chain D, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|F Chain F, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|H Chain H, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|J Chain J, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|L Chain L, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|N Chain N, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGL|P Chain P, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
The Jaz1 Degron
pdb|3OGM|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
pdb|3OGM|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And The
Jaz1 Degron
Length = 592
Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
Query: 260 PSLQQLTLLFYGARRPRVVEVARS-PHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVT- 317
P+++ + L + G ++E +R P+L+KL++ F++ ++K PSL L+V
Sbjct: 463 PNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQG 522
Query: 318 -RCCLPGK 324
R + G+
Sbjct: 523 YRASMTGQ 530
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.139 0.425
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,896,269
Number of Sequences: 62578
Number of extensions: 323465
Number of successful extensions: 859
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 857
Number of HSP's gapped (non-prelim): 4
length of query: 347
length of database: 14,973,337
effective HSP length: 100
effective length of query: 247
effective length of database: 8,715,537
effective search space: 2152737639
effective search space used: 2152737639
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)