Citrus Sinensis ID: 019118


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MPSSTITTITHFTRTQIADEEEKHLSSECKEVLLSLPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILASIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQIPELSQIADEPRVFATHIPFASLNLLPSMNNIKIVYICRNPFDTFISSWHFLNKLRSQGLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKKLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEVGDWVNYLSPSMVKQLSLIMEEKLDASGLSFKVAS
cccccccccccccccccHHHHHHHcHHHHHHHHHcccccccccccccEEEcEEEcccccHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHccccccEECcccccccccccccccccEEEEEEcccccEEEEHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHcccccccccccccccccccECccccccccccccHHHHHHHHHHHHHHccccccEEECcc
****************************CKEVLLSLPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILASIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQIPELSQIADEPRVFATHIPFASLNLLPSMNNIKIVYICRNPFDTFISSWHFLNKLRSQGLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKKLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEVGDWVNYLSPSMVKQLSLIMEEKLDASGLSFKVA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSSTITTITHFTRTQIADEEEKHLSSECKEVLLSLPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILASIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQIPELSQIADEPRVFATHIPFASLNLLPSMNNIKIVYICRNPFDTFISSWHFLNKLRSQGLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKKLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEVGDWVNYLSPSMVKQLSLIMEEKLDASGLSFKVAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytosolic sulfotransferase 15 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of hydroxyjasmonates, with a preference for 12-hydroxyjasmonate over 11-hydroxyjasmonate. No activity with 12-hydroxyjasmonic acid methyl ester, cucurbic acid, 7-iso-cucurbic acid, 6-epi-cucurbic acid, 6-epi-7-iso-cucurbic acid and their methyl esters, prostaglandin E2, arachidonyl alcohol and 11-eicosenol.probableQ8L5A7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q44, chain A
Confidence level:very confident
Coverage over the Query: 15-284,314-343
View the alignment between query and template
View the model in PyMOL