Citrus Sinensis ID: 019131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKDVL
ccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEECccccccCCcEEECccccccccccHHHHccccccccccccccccccccccHHHHHHHHccHHHHHHccccccEEEEEEEEccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccc
MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVES*N*LS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKDVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-ketoacyl-CoA thiolase 2, peroxisomal Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth. Confers sensitivity to 2,4-dichlorophenoxybutiric acid (2,4-DB). Required for local and systemic induction of jasmonic acid (JA) biosynthesis after wounding. Seems to be involved in JA biosynthesis during senescence.probableQ56WD9
3-ketoacyl-CoA thiolase Catalyzes the final step of fatty acid oxidation in which acetyl-CoA is released and the CoA ester of a fatty acid two carbons shorter is formed.probableC6DI66
3-ketoacyl-CoA thiolase Catalyzes the final step of fatty acid oxidation in which acetyl-CoA is released and the CoA ester of a fatty acid two carbons shorter is formed.probableQ6DAP6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.16Acetyl-CoA C-acyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WU9, chain A
Confidence level:very confident
Coverage over the Query: 2-331
View the alignment between query and template
View the model in PyMOL