Citrus Sinensis ID: 019155

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MEITGLKFIADTANLLSNTAHSDKKSKMVNPDSKEEDSMSLVDSSGPDEFLTAVNRRSVADDVELEIFAERGKKESDESNPMIPEQHEETKRAVIQLDQVPRWGVNSVCGKRPEMEDAVAVIPAFLQIQTHVLMDTVTDQFPDQVLVHFFGVYDGHGGCQVANYCCERMHLALAEELVTAKARLQDGGSWQEQWKKAFANSFLKVDSEIGGALGGEPVAPETAGSTAVVAIISPTLIIVANCGDSRAVLCRGKVPVPLSVDHKPDREDELARIEAAGGKVIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPDVMFVPRAKEDDCLILASDGLWDVMNNEEACDVA
ccccccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccCEEEEEECcccccccccEEEEcccHHHHHHHHcccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEccEEEEEEccccCEEEECccCEEccccccccccHHHHHHHHHcccEEEEccccCEccEEEHHHccccccccccccccccEEEEEccccccEEEEEccccccccccHHHHccc
***TGLKFIA***************************************************************************************DQVPRWGVNSVCGKRPEMEDAVAVIPAFLQIQTHVLMDTVTDQFPDQVLVHFFGVYDGHGGCQVANYCCERMHLALAEELVTAKARLQDGGSWQEQWKKAFANSFLKVDSEIGGALGGEPVAPETAGSTAVVAIISPTLIIVANCGDSRAVLCRGKVPVPLSVDHKPDREDELARIEAAGGKVIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPDVMFVPRAKEDDCLILASDGLWDVMNNEEACDVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEITGLKFIADTANLLSNTAHSDKKSKMVNPDSKEEDSMSLVDSSGPDEFLTAVNRRSVADDVELEIFAERGKKESDESNPMIPEQHEETKRAVIQLDQVPRWGVNSVCGKRPEMEDAVAVIPAFLQIQTHVLMDTVTDQFPDQVLVHFFGVYDGHGGCQVANYCCERMHLALAEELVTAKARLQDGGSWQEQWKKAFANSFLKVDSEIGGALGGEPVAPETAGSTAVVAIISPTLIIVANCGDSRAVLCRGKVPVPLSVDHKPDREDELARIEAAGGKVIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPDVMFVPRAKEDDCLILASDGLWDVMNNEEACDVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase 2C 77 Repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, osmotic water permeability of the plasma membrane (Pos), high light stress, response to glucose, seed germination and inhibition of vegetative growth. During the stomatal closure regulation, modulates the inward calcium-channel permeability as well as H(2)O(2) and oxidative burst in response to ABA and dehydration. Controls negatively fibrillin that is involved in mediating ABA-induced photoprotection. May be implicated in ABA content regulation. Involved in acquired thermotolerance of root growth and seedling survival. Required for the Erwinia amylovora harpin-induced (HrpN) drought tolerance. Involved in the hydrotropic response.probableO04719

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QN1, chain B
Confidence level:very confident
Coverage over the Query: 98-344
View the alignment between query and template
View the model in PyMOL